Krimpen aan den IJssel Local Businesses

Navigation:	Title:	Summary:
Start page ⁷⁸²⁵⁰⁵	onderde.nl	All websites under the .nl top-level domain organised by categories, keywords and locations.
↳Netherlands ⁴²³⁶⁰⁵	Dutch websites by location	Websites related to specific locations in the Netherlands, including cities, towns, and regions.
↳Netherlands→South-Holland ⁹²³⁸²	South Holland: Local Businesses & Services	This collection of websites features a diverse range of local businesses and service providers across South Holland.
↳Netherlands→South-Holland→Krimpen aan den IJssel ⁶²⁷	Krimpen aan den IJssel Local Businesses	This category features a diverse range of local businesses and organizations located in and around Krimpen aan den IJssel. Websites listed cover services such as automotive, moving, construction, healthcare, leisure, and professional services.

627 Websites:	Organisations:	Summaries:	Related categories:	Related keywords:	Related locations:
ecsnederland.nl	Electric Control Systems	ECS Nederland offers industrial automation and engineering solutions, with a focus on the automation of movable traffic bridges.	Automation → Control Systems ²¹⁰ Civil & Infrastructure → Bridge Construction ³¹	control system ¹³⁰ hydraulic ²³⁴ bridge ⁵⁵⁷ engineering ¹⁴⁶⁸ automation ²⁶⁸²
kenny-it.nl	Kenny-IT	Kenny Sinkeler kenny-IT is a company providing comprehensive IT solutions, including website, network, and server management.	IT → System Management ²⁷² Web Development → Front-End Development ⁴⁸⁷	laravel ¹⁸² server ¹⁰³⁶ network ¹¹¹²³
reparatiecentrale-witgoed-rotterdam.nl	ReparatieCentrale Witgoed Rotterdam	The website of ReparatieCentrale Witgoed Rotterdam offers professional appliance repair services in Rotterdam and the surrounding areas. The aim is to provide a reliable and quick repair service with experienced technicians and transparent rates.	Household Appliances → Appliance Repair ²²⁴ Repair → Mobile Phone Repair ¹⁰¹²	technician ⁸¹⁵ appliance ⁹⁵⁶ rate ²⁶⁰⁶ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
ontstoppingsbedrijf-capelle-aan-den-ijssel.nl	Rioolprobleemkwijt.nl	The website offers a professional unclogging service and related sewer services in the Capelle aan den IJssel region.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Sanitary Services ¹⁰⁸	pipe ⁶⁹⁵ drain ⁸⁸⁶ problem ²²¹⁴ network ¹¹¹²³ repair ¹⁴⁵⁷⁶	Capelle aan den IJssel → Schollevaar ³⁷
brammuys.nl	Bram Muys	The website of Vishandel Bram Muys presents a traditional family business that has been selling fresh fish and related products at various markets in the Netherlands since 1978. The company also offers homemade casseroles, stir-fries and salads, and provides fish dishes to order.	Fish & Seafood → Fish ³⁸⁸	casserole ¹² fish dishes ⁴⁷ fish ¹¹²¹ salad ²⁴⁴⁴ market ²⁷⁷²	Amsterdam → North ⁶⁵⁷
lisett.nl	Lisett Interieurontwerp	The website of Lisett Interieurontwerp offers interior design and consulting services in Krimpen aan den IJssel and Rotterdam, catering to both private and business clients.	Interior Design → Interior Styling ⁶⁷⁶	interior consulting ²³ styling advice ⁹⁶ interior design ¹⁸⁰² portfolio ⁶⁸⁵⁴ interior ⁸⁰⁹³	South-Holland → Rotterdam ²⁵⁰⁴⁸
berktas-sz.nl	Berktas Sociale Zekerheid	The website of Berktas Sociale Zekerheid presents the services of a private company that provides support to social affairs departments.	Legal → Guardianship ⁸⁷⁹ Community → Social Issues & Welfare ²⁸¹⁵⁹	representation ¹⁰⁰ counseling ⁷⁴¹ guardianship ⁷⁶⁷ legal ⁹³⁷	Voorne aan Zee → Brielle ⁶¹³
hairclubleonie.nl	Leonie Boskamp	The website of Hairclub Leonie is a hair salon in Krimpen aan den IJssel catering to both men and women, offering services such as haircuts, coloring, and highlights.	Services → Hairdressers ¹⁰²¹	highlights ¹⁰⁹ hairstylist ¹⁷¹ coloring ⁵⁹¹ hair salon ⁷¹⁷ haircut ¹¹⁵⁸
vuurwerkbestelling.nl	Vuurwerkbestelling.nl	The website Vuurwerkbestelling.nl is an online shop that sells fireworks and helps users to find a dealer nearby.	Party Supplies → Fireworks ²⁵⁸ Planning → Route Planning ⁷⁸	postcode ²²¹ place ²⁴² fireworks ⁴¹³ dealer ⁷⁵⁷ assortment ⁷⁷⁹⁹ webshop ⁸⁶⁴⁸	Heerlen → Hoensbroek ³⁷¹
airporttaxi247.nl	24/7 Voordelig Van En Naar Ieder Vliegveld	The website provides 24/7 airport taxi services, including nationwide coverage and online booking options.	Flights → Airports ³³⁸ Taxi & Ride Services → Taxi ¹⁰⁶²	coverage ³⁴⁸ airport ⁷⁸⁹ taxi ²⁰⁹⁰ book ¹¹³⁹⁶	Oisterwijk → Haaren ²⁵⁵
stormsystems.nl	Storm Systems B.V.	Storm Systems B.V. provides management and maintenance services for UPS (Uninterruptible Power Supply) systems, ensuring businesses have continuous power during outages.	Consulting → Technical Consulting ³⁸² Energy & Sustainability → Energy Storage ⁶³²	ups system ¹³ power outage ⁸⁴ monitor ¹⁰⁶³ maintenance ²⁰⁰⁹³
pannenkoe.nl	Pannenkoe	The Pannenkoe website presents a chain of restaurants specializing in pancakes and offers various services including reservations, takeaway and delivery options, birthday parties, and a franchise concept.	Family & Themed Dining → Pancake Restaurants ¹⁶⁶ Parties → Birthday Parties ¹⁰⁰⁸	birthday party ²²³ pancakes ⁵⁶⁸ promotion ²⁰⁶² reservation ³³⁷³ menu ¹³⁸⁵⁶	Vijfheerenlanden → Leerbroek ³⁵
ijsselgemeenten.nl	IJsselgemeenten	The website IJsselgemeenten provides information and services to residents of the municipalities of Capelle aan den IJssel, Krimpen aan den IJssel, and Zuidplas, particularly in the areas of social affairs, ICT, and benefits.	Social Affairs → Benefits ⁶⁰ Economy → Employment & Labor ⁶⁰⁵⁹	benefit ²⁴⁷ ict ¹⁰⁴⁹ subsidy ²⁶⁴⁹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
dcmr.nl	DCMR	The DCMR website provides information and services related to environmental inspections, enforcement, and promoting a healthy and sustainable living environment in the Rijnmond region.	Government & Administration → Regional Government ³⁶⁷ Context → Environment ⁵⁴⁴³⁷	enforcement ¹⁰⁷ circular economy ³⁶⁵ permit ⁷⁴⁴ inspection ⁴²⁷⁹ report ⁴⁵⁵¹	Krimpenerwaard → Bergambacht ³⁰³
ysl.nl	Stichting IJsselland Ziekenhuis	The IJsselland Ziekenhuis provides top-tier care to patients in the region and offers various services and information to visitors.	Digital & Telehealth → Patient Portals ³²⁹ Hospital & Acute Services → Hospitals ⁷³⁵	hospital ⁵⁶⁰ clinic ¹⁰⁷⁹ patient ⁴⁰⁸² appointment ¹³⁵¹⁰	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
oogvoororen.nl	Oogvoororen B.V.	The website Oogvoororen.nl offers a wide selection of hearing aids, accessories, and related services, including leasing and online ordering.	Hearing Problems → Hearing Aids ¹¹⁰ Technology → Electronic Goods ⁸⁴	hearing aids ¹⁴⁶ fee ⁶⁴⁰ webshop ⁸⁶⁴⁸ accessories ¹²⁹⁷⁵	Voorne aan Zee → Brielle ⁶¹³
erichullegie.nl	Leemans Kredieten and Koos Rook Hypotheken	The website provides information and tools related to loans, mortgages and tax matters.	Finance → Loans & Credit ¹⁹⁷⁹ Government & Legal → Tax ¹³²²	loan ⁸³² tax ²¹⁰⁰ mortgage ⁴⁵⁶⁴
comenius.nl	Comenius College	The website of Comenius College provides information about the school, its programs and services, and offers support for parents and students.	Secondary Education → VMBO ³³² Secondary Education → VWO ⁴⁸	registration ⁴³⁶⁶ student ⁷⁶²³ school ⁷⁸⁵⁶	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
autodepee.nl	Autobedrijf de Pee	Autobedrijf de Pee is a BOVAG-certified car dealership specializing in the sale, maintenance, and repair of passenger cars and commercial vehicles, as well as providing supplementary services.	Cars (Brands) → Toyota ¹⁴⁵ Road Services → Automotive Maintenance ¹⁸⁸³	insurance ⁶³⁵⁹ webshop ⁸⁶⁴⁸ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
mypadelclub.nl	My padel club	My padel club is a premium padel club in the Netherlands offering padel courts in various locations.	Tennis → Padel ⁸⁸⁰	padel court ¹⁷² lesson ⁵¹⁵⁴ news ¹⁵²⁹³	Dijk en Waard → Heerhugowaard ²⁰¹¹
basicwash.nl	Basic Wash	The website offers an unlimited car wash subscription at various locations in Brabant and South Holland.	Maintenance & Services → Car Wash ⁴⁹⁵ Mobile Phones → Subscriptions ¹⁵⁵	license plate ²³⁵ car wash ³⁵² subscription ³²⁸⁷ car ¹⁰⁸⁶⁵	Rucphen → St. Willebrord ¹⁴¹
tandarts.nl	Tandarts.nl	This website provides information about all aspects of oral health, including dental anxiety, emergency treatments, and a list of dentists by location.	Adult & Continuing Learning → Professional Development ²⁰⁸⁰ Health → Medical Care & Services ²⁹⁴⁶¹	oral health ⁶⁸⁶ prevention ¹⁷⁶³ dentist ²⁵¹⁴ treatment ²¹²⁰³	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
krimpenaandenijssel.nl	Municipality of Krimpen aan den IJssel	The website of the Municipality of Krimpen aan den IJssel provides information and services for residents and businesses.	Municipalities → Dutch Municipalities ⁵¹⁶ Government & Administration → Municipal Services ⁸³⁴	traffic ⁹¹⁶ topic ¹²³⁸ waste ¹³¹² regulation ¹³⁵⁰ tax ²¹⁰⁰
casteleijnbakker.nl	Casteleijn Brood B.V.	The website of Bakkerij Casteleijn presents a traditional bakery with stores in various locations and an online shop offering delivery service.	Bakery & Food Production → Artisan Bakeries ⁷⁷	family business ⁷⁹³ pastries ⁹⁴⁶ online shop ¹³¹⁰ bread ¹⁶²² store ³⁹⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
sor.nl	Stichting Ouderenhuisvesting Rotterdam	The website of SOR describes a foundation focused on providing affordable and safe housing for seniors in the Rotterdam region and surrounding municipalities, with the goal of creating a ‘sense of home’ for these seniors.	Senior & Assisted Living → Senior Housing ⁴⁷⁴ Sustainable Living → Housing Associations ³²⁵	participation ¹⁴³⁰ resident ³²⁴⁵ housing ⁴³⁷⁸ region ⁵⁴¹² maintenance ²⁰⁰⁹³	South-Holland → Hoeksche Waard ²²²⁹
schilten.nl	Schilten Schoonmaak	The website of Schilten Schoonmaak presents professional cleaning services and products, aimed at businesses and various sectors in the Drechtsteden area.	Jobs → Vacancies ¹⁰⁹⁹ Social Services → WMO ¹⁶²	service provision ⁸² relationship ⁴²⁰⁵ cleaning ⁴⁵⁶⁷ collaboration ¹⁶⁰³⁶	Vijfheerenlanden → Vianen ⁷⁰⁷
muziekschoolkrimpen.nl	Muziekschool Krimpen	The website of Muziekschool Krimpen presents its course offerings, services, and general information about the music school, including job vacancies, news, and contact details.	Music Education → Music Schools ³⁶⁷	music lesson ⁴⁶⁷ adults ⁶¹⁷ trial lesson ¹⁴³³ child ¹¹⁵⁶⁶ course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹
kinderdam.nl	Kinderopvang Rotterdam	The Kinderopvang Rotterdam website provides an overview of various childcare options in the Rotterdam-Rijnmond region, including preschools, daycare centers, after-school care (BSO), and nanny services, and offers information on enrollment, opening hours, and contact details.	Childcare → After-School Care ⁷⁶⁵ Childcare → Preschool ⁵¹²	daycare center ¹⁸⁰ bso ³³⁵ preschool ⁴⁹⁵ childcare ³⁵¹²	Rotterdam → Hoogvliet ⁵¹⁶
stormconnect.nl	Storm Connect B.V.	The website of Storm Connect B.V. presents the services of an internationally operating company specializing in the installation and maintenance of advanced telematics products and networks.	IT → Network Management ⁷⁰² Civil & Infrastructure → Infrastructure ¹⁰³³	telematics ³⁶ connection ⁴⁰⁰⁷ equipment ⁴¹⁴³ network ¹¹¹²³ installation ¹³⁷⁴²
svkrimpen.nl	Schaakvereniging Krimpen aan den IJssel	The website of Schaakvereniging Krimpen aan den IJssel provides information about the association, its activities, youth programs, events, and competitions.	Associations → Sports Associations ¹⁰⁸² Board → Chess ⁴⁶⁸	chess club ¹²³ evening ²⁸⁷ youth ³¹²⁶ competition ⁴⁷⁵⁹ event ⁴⁵¹⁹⁹	Westland → 's-Gravenzande ⁵⁹⁹
autobedrijfblok.nl	Autobedrijf Blok	Autobedrijf Blok is an auto dealership that sells cars, provides maintenance and repair services, and offers various other services.	Repair → Garage ¹⁷⁷⁹ Automotive → Car Dealerships ¹⁶⁴⁷	mot ⁸⁰⁶ occasion ²⁰³⁶ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
roodhuizen.nl	Roodhuizen	The website of André Roodhuizen is a portfolio and contact page for a wedding photographer specializing in capturing weddings and other events. The site offers examples of his work and information about various wedding locations.	Journalistic Visuals → Photojournalism ⁸⁵	imagery ²⁰⁰ moment ¹⁰³⁴ photographer ¹³⁶⁶ wedding ⁴²⁵⁸ event ⁴⁵¹⁹⁹	Oost Gelre → Groenlo ⁴²¹
desalonkrimpen.nl	The Salon	The Salon is a beautysalon in Krimpen aan den IJssel that specializes in skin improvement and offers various treatments.	Coaching → Burnout Coaching ¹⁷ Dermatology → Skin Therapy ⁶⁶¹	rosacea ²⁶ skin analysis ³⁶¹ skin improvement ¹⁰⁵⁸ wellness ¹⁵⁶¹ treatment ²¹²⁰³ coach ²⁵⁸¹⁰
natuurlijkcentrumzuid.nl	Van Herk Nieuwbouwmakelaars	The website of Centrum Zuid presents a new construction project called KING, consisting of apartment buildings in Krimpen aan den IJssel, offering both for-sale and rental apartments, with a focus on sustainability and a green living environment.	New Construction → Neighborhood Development ⁹³³ Ecology & Environment → Climate ¹⁶³	outdoor space ²⁴⁶ green ⁸⁸⁹ apartment ⁵⁰⁸⁸ sustainability ¹⁸⁴⁵¹
antroposofierotterdam.nl	Antroposofie Rotterdam	This website serves as a starting point for information and activities related to the anthroposophic movement in Rotterdam.	Social Organization → Religious Organizations ¹⁰⁶⁹ Philosophy → Anthroposophy ¹⁶	anthroposophy ⁹² library ⁹⁸⁸ therapy ⁷⁴⁴⁸ care ¹²³³⁸	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
conforte.nl	ConForte	Samen sterk voor ouderenzorg is a branch organization that focuses on pooling knowledge and promoting collaboration within the care sector in the Rotterdam, Capelle, and Krimpen region.	Palliative & End-Of-Life Care → Elderly Care ¹⁰⁶¹ Associations & Groups → Industry Associations ⁵⁴⁸	care sector ¹⁰ campaign ³⁴²⁸ knowledge ³⁵²⁸ network ¹¹¹²³ care ¹²³³⁸ collaboration ¹⁶⁰³⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
lucky-pins.nl	Lucky Pins	Lucky Pins is a webshop selling handmade ‘Lucky Pins’ to help customers shine at competitions.	Hobbies → Collectibles ⁷⁷³ E-Commerce → Marketplaces ¹⁰⁵³	equestrian ¹³⁸ webshop ⁸⁶⁴⁸
stormserviceandtrading.nl	Storm Service & Trading B.V.	The website of Storm Service & Trading B.V. presents a globally operating company specializing in the maintenance and repair of marine engines, as well as the sale of spare parts.	Maritime → Ship Maintenance ²⁹ Electrical Engineering → Inspection ⁵⁹⁰	marine engines ¹² diagnosis ¹⁴⁹⁰ certification ³³⁸⁰ part ⁵⁰⁴⁴ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³
crimpenhof.nl	Crimpenhof	The Crimpenhof website provides information about the shopping center, including opening hours, shops, news, and events that take place in the shopping center.	Commerce → Shopping Centers ¹⁰⁰¹ Events → Shopping Center Events ⁴⁰	shopping center ⁴⁹¹ opening hours ²⁹⁵³ shop ⁶⁴⁸³ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹
svzh.nl	Samenwerkende Vrijescholen Zuid-Holland	The website of the Samenwerkende Vrijescholen Zuid-Holland (SVZH) provides information about eight anthroposophical primary schools in South Holland, their activities, strategic plan and job vacancies.	Primary Education → Free Schools ⁶⁴	strategic plan ²⁷ free school ³¹ anthroposophy ⁹² primary school ¹⁴⁰ vacancy ⁶⁵⁹⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
buijsscheepsbouw.nl	Gebroeders Buijs Scheepsbouw BV	The website of Gebroeders Buijs Scheepsbouw BV describes the history, services, and projects of a shipbuilding company with over 165 years of experience.	Maritime → Shipbuilding ⁵⁶⁸ Context ¹⁶¹³⁹⁴	hull ⁶³ training company ⁹⁶ shipbuilding ¹⁴⁸ section ¹⁹⁰ repair ¹⁴⁵⁷⁶
autodrome-nederland.nl	AutoDrome Nederland	The website of AutoDrome Nederland showcases the entire Kia range, including new models, used vehicles, maintenance services, and contact information, and serves as an official Kia dealer for the Krimpenerwaard region.	Maintenance & Services → Auto Repair Services ⁷⁹⁴ Automotive → Cars (Brands) ⁴³⁶	used vehicle ²³ kia ³³ dealer ⁷⁵⁷ model ³⁵⁴⁶ maintenance ²⁰⁰⁹³
storm-groep.nl	Storm Group	The Storm Group is a collection of specialized, independent companies offering various services in the industrial, marine, and shipping sectors.	IT → Network Management ⁷⁰² Maintenance & Repair → Industrial Maintenance ⁷³²	marine engines ¹² reconditioning ²⁴ telematics ³⁶
snackbardekrim.nl	Snackbar de Krim	The website of Snackbar de Krim presents the menu, opening hours, delivery options, and promotions of the snack bar, which has been a local institution in Krimpen aan den IJssel for 45 years.	Quick Bites → Snack Bar ⁵⁸⁰ Food Delivery → Delivery ²²²⁷	hamburger ³⁶⁴ fries ²⁷⁵³ snack ²⁹¹⁶ coffee ³⁸³⁸ menu ¹³⁸⁵⁶
hofdriekamp.nl	Hof Driekamp Krimpen aan den Ijssel	The website of Hof Driekamp Krimpen aan den Ijssel presents a new residential area, Halvinkhuizen, in Putten, with 1,250 homes, and offers information about the area, including location, sustainability, financing, and offerings.	Sustainable Living → New Developments ²⁰⁰ Local Communities → Villages ¹⁰⁰⁵	generation ¹⁵⁶ neighborhood ²⁴²⁴ community ⁷⁹³¹ home ⁷⁹⁷⁶ nature ⁹⁰⁹⁴ sustainability ¹⁸⁴⁵¹	Gelderland → Putten ¹⁰⁶⁹
vanwaningstichting.nl	Van Waning Foundation	The Van Waning Foundation aims to promote knowledge and interest in historical inland shipping, particularly in the Hollandse IJssel and the Lek.	Foundations → Cultural Foundations ¹⁰¹ Nature → Waterways ¹⁶¹	inland shipping ³² ship ⁵¹⁰³ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷	The Hague → Leidschenveen-Ypenburg ³⁹⁵
aathuiszorg.nl	A&A Thuiszorg	A&A Thuiszorg provides home care services and household assistance in the Voorne, Hoeksche Waard region and surrounding areas.	Care → Personal Care ⁵⁹² Social Services → Needs Assistance ¹¹	wlz ⁵⁶ household help ¹⁰⁶ caregiving ³⁶⁸ home care ⁸²⁷ care ¹²³³⁸	Nissewaard → Spijkenisse ¹⁴³³
myhealthclub.nl	My HealthClub	My HealthClub is a premium sports, fitness, and wellness club in the Netherlands that provides personalized sports advice and a wide range of sports opportunities, including padel, to help members become fitter, more energetic, and achieve their goals.	Tennis → Padel ⁸⁸⁰ Group Class → Fitness Centers ¹⁰¹⁰	sports club ²³⁸ padel ⁶⁰² wellness ¹⁵⁶¹ fitness ²²⁵¹	Dijk en Waard → Heerhugowaard ²⁰¹¹
dietistencoalitie010.nl	DiëtistenCoalitie010	The website of DiëtistenCoalitie010 (DC010) provides information about a regional collaboration of first-line dietetics practices in Rotterdam and surrounding areas, with the aim of improving and promoting nutrition care among healthcare providers and organizations. It serves as a contact point for questions and referrals regarding nutrition.	Specialized Medical Services → Specialized Care ³⁸⁴ Nutrition → Dietetics ⁸¹⁶	healthcare insurer ²⁷ referral ³⁷⁷ nutrition ⁴⁹³⁵ care ¹²³³⁸ collaboration ¹⁶⁰³⁶	Rotterdam → Pernis ¹⁴²
joodserfgoedrotterdam.nl	Montefiore Rotterdam Foundation	This website provides information about the Jewish history and heritage in Rotterdam and the surrounding area, focusing on historical traces, cultural aspects, and the development of the Jewish community.	Local History → Dutch History ¹⁰⁶⁷	jews ⁴⁰ synagogue ⁶⁹ history ⁷²⁸⁶ community ⁷⁹³¹	Voorne aan Zee → Brielle ⁶¹³
rotterdamsefondsen.nl	Vereniging Rotterdamse Fondsen (VRF)	The Rotterdamse Fondsen website is a directory that lists wealth funds in the city and region of Rotterdam, helping organizations and projects find financial support.	Social Organization → Welfare Organizations ¹⁷³ Initiatives & Collaboration → Initiatives ⁴⁵⁹	target group ⁵⁷⁸ fund ¹⁰⁶³ initiative ¹²⁹⁷ region ⁵⁴¹²	Voorne aan Zee → Brielle ⁶¹³
overheidinzuidholland.nl	OverheidInNederland	The website provides information about the province of South Holland, including municipalities, water authorities, and officials.	Municipalities → Governance ¹⁰⁴³ Government & Administration → Regional Government ³⁶⁷	official ⁴⁸ water authority ⁵⁸ political party ⁷⁵ statistics ³⁹² province ⁵¹⁸ municipality ⁶⁸³⁷	South-Holland → Molenlanden ¹³⁴⁹
scoutingjwf.nl	Scouting Jan Willem Friso	The website of Scouting Jan Willem Friso in Krimpen aan den IJssel presents the activities, volunteers, and sections of the scouting group, which is geared towards youth aged 7 to 18.	Youth Organizations → Scouting ¹⁰⁰⁴	scouting ⁸⁶⁰ water ²⁵⁰¹ youth ³¹²⁶ volunteer ⁸³⁶⁷
dcvkrimpen.nl	De Club Vereniging Van”	The website of DCV (De Club Vereniging Van’) provides information on the various sports teams, events, and club activities.	Sports Activities → Football ⁴¹⁴⁴ Associations → Sports Associations ¹⁰⁸²	football ¹³⁴⁷ sponsorship ²⁶⁸⁶ association ⁸⁵⁶² membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	Vlissingen → Lammerenburg ³⁸
mhckrimpen.nl	MHC Krimpen	The website of MHC Krimpen is an information platform for the hockey club MHC Krimpen, providing news, an agenda, team information, sponsorship details, and contact information.	Sport Organization → Hockey ⁵⁵⁰ Context ¹⁶¹³⁹⁴	hockey ³⁴⁸ sponsorship ²⁶⁸⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴² news ¹⁵²⁹³
whsports.nl	W&H Sports	The website of W&H Sports provides solutions for equipping sports facilities, supporting sports clubs, and supplying a wide range of sports equipment.	Camping → Facilities ¹⁹⁹ Apparel → Sporting Goods ¹³⁷⁴	sports facility ²⁸ sports field ⁷⁵	Breda → North ³⁵
eetcafedecrimpenaar.nl	Stichting Dagbesteding Krimpenerwaard	Eetcafé De Crimpenaar is a cafe located in Krimpen aan den IJssel offering a cozy atmosphere and a wide variety of dishes suitable for different occasions.	Bars → Pubs ⁵⁴⁶ Beer → Breweries ³³⁷	job postings ⁶⁷⁶ cafe ¹⁶²² hospitality ³⁴⁹¹ terrace ⁴⁸⁴⁷ catering ⁶⁴⁵⁶ menu ¹³⁸⁵⁶
sportverenigingdetreffers.nl	Handbalvereniging SV De Treffers	Handbalvereniging SV De Treffers is a handball club in Krimpen aan den IJssel that provides members with a fun handball experience and emphasizes sportsmanship and camaraderie.	Sports Clubs → Dutch Sports Clubs ³³⁷ Team Sports → Handball ²⁴²	handball ²⁰⁹ club ⁴²²⁵ competition ⁴⁷⁵⁹ member ¹⁰¹⁵⁴
dikbox.nl	Dik Box	The website showcases the work of artist Dik Box, including exhibitions, projects, and a selection of his artwork.	Visual Arts → Installation Art ⁵⁷⁶ Galleries & Exhibitions → Exhibitions ¹⁰⁸³	visual art ¹³⁶ artwork ²²⁴⁸ exhibition ⁵³³² artist ⁵⁷⁴⁵	North-Holland → Haarlem ⁸⁶⁷⁴
streefkerktrading.nl	Streefkerk Trading (V.O.F.)	The website of Streefkerk Trading is an online shop where company clothing and safety products can be ordered.	Safety & Security → Safety ²⁴⁴¹	company clothing ²¹ safety products ³⁴ safety glass ⁵⁷ webshop ⁸⁶⁴⁸
fastcomexpress.nl	Express Vervoer	Express Vervoer is a specialist in international fast transport, offering services ranging from air freight and courier services to moving services and airport transport.	Freight & Logistics → International Transportation ⁵⁷⁶	moving service ⁵⁰ air freight ⁷⁷ courier service ¹⁰⁹ transport ⁶¹⁰⁵	Eersel → Knegsel ¹³⁵⁹
bromo.nl	Bromo.nl	The website offers courses and exams for obtaining a scooter theory and driving license in the Netherlands.	Traffic Management → Traffic ⁵⁸⁹ Driver & Vehicle → Driver’s License ¹⁶²⁵	theory ⁹⁵⁶ license ¹²⁸⁸ exam ²¹²⁰ package ⁶¹¹² practice ⁹⁰⁸⁹ course ¹⁴⁷²⁸	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
vonkdiervoeders.nl	Vonk Diervoeders	Vonk Diervoeders is a pet store offering a wide range of animal feed and supplies, and where customers can receive expert advice.	Animals → Pet Stores ⁴⁷⁸	feed ⁶⁷² supply ⁹⁶¹ store ³⁹⁰¹	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
vlraccountants.nl	VLR accountants	VLR accountants is an accounting firm that provides clients with administrative services, audit, and advice, focused on a long-term partnership.	Business Services → Finance & Accounting ⁶⁶¹³	tax services ¹³² audit ⁶²² account ⁵⁷⁸¹ administration ⁶⁵⁸⁷	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
aandenijssel.nl	Samenwerkingsverband passend primair onderwijs Aan den IJssel	Samenwerkingsverband passend primair onderwijs Aan den IJssel is a foundation formed by ten school districts and all affiliated schools, dedicated to organizing and providing tailored education for 9,500 students in three municipalities.	Social Issues & Welfare → Disability Services ⁹⁴⁹ Special Needs & Support → Support ²⁰⁰⁶	support plan ²³ inclusive education ⁸⁴ municipality ⁶⁸³⁷ school ⁷⁸⁵⁶ collaboration ¹⁶⁰³⁶	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
greenbrains.nl	greenbrains.nl	The website features a blog with articles on local topics, including barbers in Westervoort, weather in Valkenburg, and gasoline prices in Krimpen aan den IJssel.	Travel Guides → Regional Travel Guides ⁸⁵ Local & Regional → Local News Websites ³⁵⁸	subfloor ⁴⁶ barber ⁴¹⁸ weather ⁸¹⁷	Valkenburg aan de Geul → Valkenburg ⁹²²
blue-house.nl	Blue-house B.V.	The website of Blue-house presents the company as a developer of housing and areas, with the aim of creating sustainable and vibrant residential neighborhoods that have a positive impact on the environment and society.	Living → Sustainable Living ⁸¹⁷	housing concept ²⁷ housing ⁴³⁷⁸ sustainability ¹⁸⁴⁵¹	Rotterdam → Charlois ³²⁸
chiropractiemedicus.nl	Chiropractie Medicus	Chiropractie Medicus is a practice located in Rotterdam and surrounding areas that focuses on treating posture-related complaints and various types of pain, utilizing an extensive approach and diverse treatment techniques.	Chronic Diseases → Pain ⁴⁵⁰ Physical Therapy → Chiropractic ⁴²⁰	chiropractic ¹⁸⁴ posture ⁵⁴⁸ technique ²¹⁵⁷ complaint ⁶⁴⁷⁹ appointment ¹³⁵¹⁰ treatment ²¹²⁰³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
stoppelenburguitvaart.nl	Stoppelenburg Uitvaartverzorging	Stoppelenburg Uitvaartverzorging provides funeral services that focus on reflecting the life story of the deceased and offering personal guidance during the grieving period.	Death → Funerals ⁵⁵²	farewell ¹¹⁰⁹ grief ¹⁵⁷⁷ funeral ²⁴⁷⁷ life ²⁶⁷³ wishes ²⁷¹⁷ story ⁸²⁸⁵	Krimpenerwaard → Schoonhoven ⁵⁴⁴
berekenuwrechtplus.nl	berekenuwrechtplus.nl	The BerekenUwRecht program helps users determine if they are entitled to a municipal allowance.	Assistance Services → Financial Assistance ²²⁴ Legal → Legal Aid ⁴²⁰	living situation ¹⁸ allowance ¹⁶³ asset ⁵⁹¹ income ⁶⁶⁰ municipality ⁶⁸³⁷	Maastricht → Maastricht-Southeast ¹¹³
meerotterdamrijnmond.nl	Stichting MEE Rotterdam Rijnmond	MEE Rotterdam Rijnmond helps people with disabilities to live independently and participate in society.	Support → Personal Support ³⁶⁰	disability ⁵⁹⁴ work ³¹²² municipality ⁶⁸³⁷ collaboration ¹⁶⁰³⁶	Albrandswaard → Rhoon ⁴⁴⁸
brouwerij-ijssel.nl	Brouwerij IJssel	Brouwerij IJssel is a brewery located in the Dutch IJssel region, offering an online shop with various beers and merchandise.	Beer → Breweries ³³⁷	brewery ⁴⁹⁸ tours ¹⁰⁴⁸ beer ²⁸⁸⁷ festival ³⁸⁰⁴ shop ⁶⁴⁸³	Oude IJsselstreek → Megchelen ³¹
vanherkgroep.nl	Van Herk Groep	Van Herk Groep is a commercial real estate management and operation company.	Investing → Asset Management ³¹⁸	asset manager ¹⁵ industrial ¹⁵⁶ retail ⁵⁸⁶ hospitality ³⁴⁹¹ real estate ⁴⁹⁸¹ portfolio ⁶⁸⁵⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
hethuisvanasporaat.nl	The house of Asporaat	The house of Asporaat is a company involved in various projects including film production, theater, and community initiatives.	Knowledge ²¹⁶⁰¹⁹	theater ²⁵⁴⁴ film ³⁰⁰⁷
ibkw.nl	Ingenieursbureau Krimpenerwaard	Ingenieursbureau Krimpenerwaard (IBKW) provides technical consulting and engineering services to the municipalities of Krimpenerwaard and Krimpen aan den IJssel.	Planning & Development → Spatial Planning ⁸⁸⁹ Manufacturing & Industrial → Engineering ³⁹¹⁹	civil engineering ⁹² spatial planning ¹⁹⁰ consulting ³⁶³⁹ municipality ⁶⁸³⁷	South-Holland → Krimpenerwaard ¹⁸⁴⁰
brugopen.nl	BrugOpen.nl	The website displays current bridge openings in the Netherlands.	Infrastructure → Bridge ³⁶ Nature → Waterways ¹⁶¹	open ⁹² update ¹⁶³ notification ¹⁸³ bridge ⁵⁵⁷	Hollands Kroon → Anna Paulowna ²⁹¹
vanherk.nl	Van Herk Makelaars	Van Herk Makelaars is a real estate agency specializing in the sale, purchase, and valuation of houses and commercial properties.	Local & Regional Focus → Local Businesses ¹⁰⁷⁷	commercial property ⁴⁶⁹ listings ⁵²⁵ award ⁶⁴² netherlands ¹³⁷⁶ appraisal ¹⁴⁸⁸ house ⁸¹²¹	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
electrotool.nl	Electrotool BV	The website of Electrotool is a specialist online shop and supplier of machines and tools for the industrial, construction, and installation industries, offering a wide range of products and a nationwide dealer network.	Machinery & Repair → Machinery ¹⁰⁴⁵	dealer network ³⁵ machine ³⁷²⁷ tool ³⁹⁰⁷	Netherlands → Utrecht ⁴⁸⁹⁰¹
zellingen.nl	De Zellingen	The website of De Zellingen provides a wide range of care and support services for various target groups, including caregivers, people with dementia, rehabilitation patients, and people with disabilities.	Home & Community Care → General Home Care ²³	household assistance ⁹⁰ daycare ¹³⁶⁵ rehabilitation ¹⁵¹² housing ⁴³⁷⁸ care ¹²³³⁸	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
meerkring.nl	Stichting Meerkring	The website of Stichting Meerkring provides information about primary education in Amersfoort, with specific focus on the 21 affiliated elementary schools and the services they offer.	Primary Education → Catholic Primary Education ³⁸⁰ Higher Learning → Educational Institutions ¹⁰⁴⁹	enrollment ¹⁴⁹ parent ⁴³¹⁸ school ⁷⁸⁵⁶ education ¹³⁴⁷¹	Enschede → Twekkelerveld ¹⁶
pierrekelder.nl	Pierre Kelder	The website pierrekelder.nl is a portfolio of Pierre Kelder, a graphic designer and web designer with over 40 years of experience in the printing and advertising industry.	Marketing → Branding & Identity ¹⁶⁰²	graphic design ²⁰⁴² webdesign ⁴⁰⁹² print ⁵⁵¹¹ portfolio ⁶⁸⁵⁴	Gelderland → Arnhem ⁸⁶⁸⁰
adealyshop.nl	Adealyshop	Adealyshop is an online store offering a wide variety of products including model building sets, 3D building kits, decorative items, gift sets, and personal care products.	Hobbies → Model Building ¹⁰⁰⁷ Local & Regional Products → Local Shops ²⁴⁵	model building ¹⁸³ gift set ²¹⁷ puzzle ⁸¹¹ bag ²³⁹⁹ decoration ⁴⁰⁸⁵
fourmonths.nl	Four Months	The website of Four Months is a specialist in maternity replacement and interim staffing, connecting professionals with companies in sectors such as marketing, communication, HR, and management support.	HR Services → Executive Search ⁷³⁷ HR Services → Intermediaries ¹⁴⁰	hr professional ¹² communication advisor ²⁹ assignment ¹¹²¹ vacancy ⁶⁵⁹⁸	Utrecht → Amersfoort ⁸⁰¹¹
dak-brouwer.nl	Roofing Company J. Brouwer	The roofing company J. Brouwer offers professional services in the field of roofing renovation, roof repair, and roof inspections. The goal is to inform and serve private customers with their roofing expertise.	Roofing → Roof Repair ⁶⁴⁷	roofing renovation ¹⁶ roof repair ¹⁷⁵ roof inspection ²⁴⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
hetonderdelenmannetje.nl	Sparepart Nederland	Sparepart Nederland is a webshop that sells parts and accessories for white and brown goods appliances.	Computer → Laptops ³⁶⁰	appliance ⁹⁵⁶ search ¹⁰²⁷ part ⁵⁰⁴⁴ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷
historischekringkrimpen.nl	Historical Circle Krimpen aan den IJssel	The website of the Historical Circle Krimpen aan den IJssel (HKK) provides information about the history, culture, and community life of the municipality of Krimpen aan den IJssel and organizes activities to keep it alive.	Local History → Dutch History ¹⁰⁶⁷ Institutions → Libraries ⁴⁰²	photo archive ⁵⁵ publication ²⁰¹⁸ exhibition ⁵³³² history ⁷²⁸⁶ member ¹⁰¹⁵⁴
rijschoolmado.nl	Rijschool Mado	Rijschool Mado offers driving lessons and courses for various vehicles in the Rotterdam area, focusing on speed and affordable options.	Driving & Vehicle → Vehicle Training ⁵⁵³	driving license ⁴⁰² driving lesson ⁷¹² trailer ¹⁶²⁴ instructor ³¹²⁶ vehicle ³⁷⁴³ course ¹⁴⁷²⁸	Albrandswaard → Rhoon ⁴⁴⁸
bwkrimpen.nl	Hervormde W.B.A te Krimpen aan den IJssel	This website provides information about the unique Reformed community of Krimpen aan den IJssel, including the Sionskerk and Rehobothkerk, its activities, and contact persons.	Christianity → Protestant Churches ¹²⁵⁷ Protestantism → Reformed ¹³²³	church ³⁴³⁹ community ⁷⁹³¹ news ¹⁵²⁹³
oggkrimpen.nl	Reformed Protestant Community in the Netherlands	This website of the Reformed Protestant Community in the Netherlands in Krimpen aan den IJssel provides information about the sermons held in the church.	Social Organization → Religious Organizations ¹⁰⁶⁹ Protestantism → Reformed ¹³²³	sabbath ¹⁷ consistory ⁷⁵ sermon ¹¹³ church service ⁸⁷⁹ church ³⁴³⁹ house ⁸¹²¹
detweesprongfinancials.nl	De Tweesprong Financial Services	The website of De Tweesprong Financial Services provides information about its services in the areas of guardianship and income/budget management.	Personal Finance → Budgeting ⁶⁷⁶ Legal → Guardianship ⁸⁷⁹	income management ⁷⁴ financial services ¹⁷¹ guardianship ⁷⁶⁷ administration ⁶⁵⁸⁷ care ¹²³³⁸	Nissewaard → Spijkenisse ¹⁴³³
vinkpc.nl	Vink Psychologisch Centrum	Vink Psychologisch Centrum is a psychological practice offering mental health care to both adolescents and adults.	Medical Care & Services → Psychiatry ⁷⁵⁶ Health → Mental & Emotional Well-Being ²³⁷⁰⁴	assessment ¹²⁰⁵ family ⁶⁴⁶² practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Nissewaard → Spijkenisse ¹⁴³³
vancappellenstichting.nl	Van Cappellen Stichting	The Van Cappellen Stichting is a foundation that supports the social, cultural, and general interests of the residents of Capelle aan den IJssel, Zuidplas, and Krimpen aan den IJssel.	Municipal Services → Grants ¹⁹³ Knowledge → Culture ⁸²⁶⁵⁹	objective ⁴¹⁵ subsidy ²⁶⁴⁹ board ³⁴³⁸ foundation ⁶⁶⁷⁸ municipality ⁶⁸³⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
ijsselstreekradio.nl	IJsselstreekradio	IJsselstreekradio is a local radio station broadcasting to the municipalities of Capelle, Krimpen, Krimpenerwaard, and Zuidplas.	Radio → Regional Radio ¹¹⁵ News & Journalism → Regional News ⁹⁴⁸	radio ¹²⁰⁰ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Capelle aan den IJssel → Schollevaar ³⁷
tritechsolutions.nl	Tritech Solutions	Tritech Solutions provides innovative and sustainable solutions for environmental protection and landscape design.	Garden Maintenance → Garden Landscaping ⁷¹¹ Environment → Environmental Technology ⁷¹²	landfill ¹⁹ seal ²⁶⁴ landscape ²⁶⁰⁹ technology ⁶⁸¹⁶	Het Hogeland → Eemshaven ¹⁴⁶
intoears.nl	IntoEars	IntoEars hearing centers provide integrated hearing care services, including hearing tests, rehabilitation, and the sale of hearing aids from various brands.	Hearing Problems → Hearing Aids ¹¹⁰	audiologist ⁵⁰ hearing aids ¹⁴⁶ rehabilitation ¹⁵¹²	Voorne aan Zee → Brielle ⁶¹³
pasarmalams.nl	Pasarmalams.nl	Pasarmalams.nl is a central calendar that lists ‘pasar’ events and similar theme festivals and markets in the Benelux region featuring authentic oriental, tropical, Asian, and exotic products and delicacies.	Local Events → Markets ¹⁰⁹⁷ Culture → Asian Culture ⁴⁰	catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Overbetuwe → Randwijk ⁶⁵
prachtlint.nl	Prachtlint	Prachtlint is an initiative focused on creating a continuous flower strip in the Krimpenerwaard by connecting dikes, banks, and meadows with flowers and plants.	Green Spaces → Landscape Management ³⁸¹ Local Government → Municipal Organizations ⁴¹⁶	strip ¹³³ dike ¹⁴⁸ bank ³⁷⁴ biodiversity ⁷²⁰ flowers ³²⁴⁸ partner ⁴²⁷²	South-Holland → Krimpenerwaard ¹⁸⁴⁰
widek.nl	Widek B.V.	The website of Widek B.V. showcases a range of bicycle accessories, particularly the Qibbel child seats, and emphasizes the Dutch production of the products.	Engineering → Product Development ⁵⁴³	child seat ¹⁹ bicycle ²⁸³⁸ production ⁴⁵⁸² accessories ¹²⁹⁷⁵
krimpenaandenijsselkrant.nl	Krimpen aan den IJssel Krant	The website krimpenaandenijsselkrant.nl provides local news reports, information about housing, and 112 reports from Krimpen aan den IJssel.	Apartment Living → For Sale ¹⁰⁰⁷ Context ¹⁶¹³⁹⁴	112 reports ²⁷ funda ⁴³ vacancy ⁶⁵⁹⁸ house ⁸¹²¹ news ¹⁵²⁹³	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
vannesoptiek.nl	Van Nes Optiek BV	Van Nes Optiek is an optician offering eyeglasses, contact lenses, and optometry services in Krimpen aan den IJssel and Zoetermeer.	Accessories → Eyeglasses ¹⁰⁵ Health → Eye & Vision ¹¹⁸⁸	optometry ¹⁰³ eyeglasses ⁴³⁷ sunglasses ⁵¹⁶ contact lenses ⁵³⁸ brand ¹⁷⁷³⁷	South-Holland → Zoetermeer ⁴⁰⁴⁶
hansbeen.nl	Hans Been Architecten BNA	Hans Been Architecten is an architecture firm specializing in designing atmospheric and sustainable environments.	Urban Planning → Urban Development ³⁷⁸ Real Estate → Project Development ⁶³³	architecture ³²²³ environment ⁴⁸⁷³ portfolio ⁶⁸⁵⁴ sustainability ¹⁸⁴⁵¹	Krimpenerwaard → Gouderak ¹⁰³
willemseverhuizingen.nl	Willemse Verhuizingen	The website of Willemse Verhuizingen offers a wide range of moving and assembly services, both nationally and internationally, with a focus on the Krimpenerwaard region and surrounding areas, as well as Rotterdam. The goal is to provide individuals and businesses with a stress-free moving experience.	Moving → Moving Companies ⁸³⁵ Construction & Building → Assembly Services ²⁰	mover ⁴⁶⁷ move ¹⁴⁴¹ assembly ¹⁷³³ storage ²⁴⁴⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
autorijschooladventure.nl	Autorijschool Adventure	Rijschool Adventure is a driving school located in Rotterdam that offers driving lessons and trial lessons.	Driver’s License → Theory Courses ²⁷⁴	driving lesson ⁷¹² trial lesson ¹⁴³³ anxiety ¹⁵⁹⁶ exam ²¹²⁰ instructor ³¹²⁶ package ⁶¹¹²	Lansingerland → Bergschenhoek ⁵⁶⁸
actievoorrodekruisrotterdamrijnmond.nl	Ready2Help	The website of Ready2Help is a disaster relief organization based in Rotterdam-Rijnmond, dedicated to providing assistance in emergencies and supporting individuals in preparing for disasters.	Humanitarian Aid → Emergency Relief ¹⁵ Social Issues → Social Organization ¹³³¹⁵	disaster ⁴⁹ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷	Lansingerland → Bleiswijk ⁵⁷⁹
steehouweruitvaart.nl	Steehouwer Uitvaart	Steehouwer Uitvaart is a funeral home located in Rotterdam offering a range of services and information related to the funeral arrangements of a deceased person.	Personal Development → Guidance ⁷⁸¹ Family → Funeral Services ²⁰⁸⁴	grief support ³⁴ funeral wishes ⁵⁶ funeral care ¹³⁵ cost ¹⁹⁹⁰ funeral ²⁴⁷⁷ wishes ²⁷¹⁷	Nissewaard → Spijkenisse ¹⁴³³
slotenmaker-rotterdam.nl	Slotenmaker Rotterdam De Keijzer	The website Slotenmaker Rotterdam De Keijzer offers 24/7 locksmith services, including door and lock opening, repair, and installation, in the Rotterdam region and surrounding areas such as Barendrecht, Ridderkerk, Capelle aan den IJssel, Vlaardingen and Schiedam.	Security Systems → Lock Systems ¹²⁴ Emergency Services → Emergency Locksmiths ¹²⁴	locksmith ⁹¹⁹ hardware ⁹⁴¹ locks ⁹⁵³ door ²²¹⁰ region ⁵⁴¹²	Lansingerland → Bergschenhoek ⁵⁶⁸
stappervastgoed.nl	Stapper Vastgoed & Hypotheken	The website Stapper Vastgoed & Hypotheken offers a range of services related to real estate, including property buying and selling, appraisals, mortgages, insurance, and tax matters. The company aims to provide customers with a complete package for their real estate needs.	Property Sales → For Sale Properties ⁹⁵ Property Sales → Buying a House ⁸⁷²	agent ¹²⁵³ tax ²¹⁰⁰ mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹ property ⁷⁴⁰⁶	Teylingen → Voorhout ⁴²⁶
delangenvdberg.nl	De Langen & van den Berg	De Langen & van den Berg is a construction and development company that manages projects from concept to completion.	Construction Companies → Residential Construction ¹⁰¹³ Real Estate → Project Development ⁶³³	commercial building ¹²⁷ housing ⁴³⁷⁸ vacancy ⁶⁵⁹⁸ construction ⁷⁴²¹	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
archiefman.nl	Archiefman	The Archiefman website provides information and access to archives, genealogy, and linguistic resources, with a focus on the regions of Midden-Holland, the Liemers, Sint Maarten (Antilles), and Zuidplas.	Genealogy & Family History → Archival Science ¹¹ Science → Linguistics ¹⁷¹	genealogy ⁵⁴³ inventory ¹⁶¹³ language ²⁰¹⁶ archive ²⁰⁶⁷ book ¹¹³⁹⁶	Montferland → Didam ⁷⁵⁹
paviljoenduivenvoorde.nl	Duivenvoorde BV	Paviljoen Duivenvoorde is a location in Landgoed Duivenvoorde, situated in the Leidsche Tuin, offering historical setting, nature and culinary experiences.	Cultural Attractions → Castles ¹⁷⁸ Accommodation → Country Estates ⁷³⁸	pavilion ¹³⁰ castle ⁴⁹⁴ event ⁴⁵¹⁹⁹	South-Holland → Voorschoten ⁸³⁰
hoveniertuinier.nl	Hoveniersbedrijf Tuinier	Hoveniersbedrijf Tuinier is a landscaping company operating in the Rotterdam and South Holland region, specializing in garden design, installation, maintenance, and related projects.	Garden Maintenance → Landscapers ²⁸⁷	garden design ⁹⁶⁴ pool ¹⁵³² roof ³⁶⁶² garden ¹³¹²⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
corverkammen.nl	Corverkammen	The website offers services related to selling cars, including scrap cars and damaged cars.	International Trade → Export ⁶⁷⁴ Driving & Lessons → Vehicles ⁵⁴¹	damage car ³⁸ auto ⁶⁷ scrap car ¹²⁷ pickup service ¹⁷² rdw ²⁶³ quote ¹²⁸⁶³	Drimmelen → Made ³³⁵
perflexxion.nl	Perflexxion Uitzendbureau	Perflexxion Uitzendbureau is a recruitment agency focused on finding suitable jobs and offering professional training and education.	HR Services → Technical Recruitment ⁴⁷⁴ Adult & Continuing Learning → Professional Training ¹²²⁴	job ²⁷⁹⁵ region ⁵⁴¹² vacancy ⁶⁵⁹⁸ training ²⁸¹³³	Voorne aan Zee → Brielle ⁶¹³
budgetsnoezelen.nl	Budgetsnoezelen	Budgetsnoezelen.nl is an online shop that sells sensory toys and fidget items, aimed at promoting play and relaxation for children.	Toys → Sensory Toys ²⁰	light show ⁹⁵ toy ²²⁹⁵
partytenthuren-rotterdam.nl	Partytent Huren Rotterdam	Partytent Huren Rotterdam is a rental company specializing in renting party tents and associated accessories in the Rotterdam region, offering a wide range of tents and rental opportunities.	Camping → Tents ³⁴⁴ Logistics & Transportation → Rental Companies ⁴¹⁴	lighting sound ¹¹ inflatable bouncer ⁶⁴ heater ¹⁸⁴ party tent ²⁵⁶ tent ¹³²⁸ furniture ⁸⁷⁵¹	Voorne aan Zee → Brielle ⁶¹³
randstadadvocaten.nl	Randstadadvocaten.nl	The website offers legal assistance to people who have suffered injuries.	Criminal Law → Personal Injury ⁷⁷¹ Legal → Lawyers ⁷⁰⁸	personal injury ⁴²⁸ legal assistance ⁵³⁷ case ¹¹⁵³ lawyer ²⁶⁸³	Bunschoten → Bunschoten-Spakenburg ³⁸²
jacdenhollander.nl	Jac den Hollander Verhuizingen	The website of Jac den Hollander Verhuizingen offers moving services for individuals and businesses in and around Rotterdam, including senior moving, business moving, school moving, and storage solutions.	Moving → Moving Companies ⁸³⁵ Moving → Quotes ¹⁷	move ¹⁴⁴¹ storage ²⁴⁴⁶ quote ¹²⁸⁶³	Lansingerland → Bergschenhoek ⁵⁶⁸
heftruckdiscounter.nl	HeftruckDiscounter	HeftruckDiscounter.nl is an online store that sells used and new forklifts, scaffolding, and related accessories, offering options for pickup, shipping, and financing.	Loading & Unloading → Forklifts ²⁵⁷ Freight & Logistics → Trucks ⁸⁹⁹	reach truck ⁴³ pallet truck ⁹² forklift ⁴⁴⁷ scaffolding ⁵¹⁹ battery ¹⁷⁵¹ light ⁵¹⁴⁸
verdoold.nl	Verdoold Makelaars	Verdoold Makelaars is an NVM-recognized real estate agency that provides services related to buying, selling, valuing, and financing homes, as well as advice in the area of insurance and mortgages.	Property Sales → Buying a House ⁸⁷² Property Agents & Brokers → Realtors ³⁴¹	buy ¹⁶⁹ sell ²³⁰ financial ⁸⁵⁵ mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹ property ⁷⁴⁰⁶	Lopik → Polsbroek ⁴⁹
zorgvoordier.nl	ZorgvoorDier	ZorgvoorDier is a company offering professional pet care services at home, including cat sitting, pet sitting, and grooming.	Animals → Animal Care ¹⁸⁴⁹	cat sitting ²¹ pet sitting ³⁶ grooming ⁸⁹⁶ pet ¹⁶¹⁷	Krimpenerwaard → Bergambacht ³⁰³
tuyter.nl	Ontmoetingscentrum De Tuyter	The Ontmoetingscentrum De Tuyter in Krimpen aan den IJssel organizes a diverse schedule of performances, concerts and other cultural activities for the local population.	Cultural Experiences → Cultural Activities ²⁷⁹ Art & Culture → Cultural Activities ¹⁵	film ³⁰⁰⁷ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶ event ⁴⁵¹⁹⁹
8baan.nl	8baan.nl	The website 8baan.nl collects and presents job vacancies offered by municipalities.	Employment & Labor → Labor ⁵⁰⁴	role ²³⁴ hr ⁸⁸⁴ administration ⁶⁵⁸⁷ vacancy ⁶⁵⁹⁸ municipality ⁶⁸³⁷	De Fryske Marren → Joure ⁶⁸⁹
nachtfort.nl	Nachtfort	Nachtfort is an initiative transforming Fort Honswijk into an artistic island, offering flexible workspaces, event venues, and cultural activities within the UNESCO World Heritage site of the Dutch Waterline.	Venues → Event Spaces ⁴³² Conferences & Meetings → Meeting Venues ⁷²⁹	fort ¹¹⁶ workspace ⁷⁹⁵ art ³⁸⁵⁶ event ⁴⁵¹⁹⁹	Almere → Almere City ⁹³⁴
zonenzo.nl	Zon & Zo	The website of Zon & Zo offers smart energy solutions to businesses, schools, governments, homeowners associations (VvE's), and individuals, with the goal of achieving energy independence and promoting sustainable energy.	Energy & Sustainability → Energy Storage ⁶³² Energy → Sustainable Energy ⁵³³	battery ¹⁷⁵¹ subsidy ²⁶⁴⁹ solar panels ⁴⁷⁰¹	South-Holland → Alblasserdam ⁸²⁶
synerkri.nl	Synerkri	Synerkri is a foundation dedicated to promoting sports and culture within the municipality of Krimpen aan den IJssel.	Childcare → BSO ¹⁰¹	outing ⁹⁸² culture ³⁹²² sport ⁴²²⁸ workshop ¹⁹³²⁵
uitagendakrimpen.nl	Uitagenda Krimpen aan den IJssel	Uitagenda Krimpen aan den IJssel offers a local events calendar listing activities such as theater, music, and cultural events.	Knowledge → Culture ⁸²⁶⁵⁹	theater ²⁵⁴⁴ culture ³⁹²² sport ⁴²²⁸ child ¹¹⁵⁶⁶ event ⁴⁵¹⁹⁹	South-Holland → Krimpenerwaard ¹⁸⁴⁰
gouda-loodgieter.nl	Folstra B.V.	Folstra B.V. is a plumber and installation company serving Gouda and the surrounding area.	Home Improvement → Plumbing ²⁷³³	pipework ⁸⁴ sanitary ⁷⁵⁰ leak ¹²⁰⁴ drainage ¹³²² heat ²¹⁸⁸ installation ¹³⁷⁴²	Krimpenerwaard → Bergambacht ³⁰³
dubbelfitfysiotherapie.nl	DubbelFit Fysiotherapie	The website of DubbelFit Fysiotherapie presents services in the field of physiotherapy and sports rehabilitation, with a focus on restoring movement problems and injuries.	Physiotherapy → Sports Physiotherapy ⁷⁴⁷ Medicine → Sports Medicine ⁵⁸⁵	sports rehabilitation ⁷¹ dry needling ⁴²⁴ movement ²³⁰⁴ physiotherapy ⁴⁶⁸⁸	Barendrecht → Rotterdam-IJsselmonde ²⁴
bbraanker.nl	B. Braanker Zonwering	B. Braanker Zonwering is a specialist in sun shading, shutters and awnings, offering advice and quotes to homeowners and small businesses.	Garden → Sun Shading ⁵⁶⁸	insect screen ⁴³ awning ⁵⁴⁶ shutters ⁶⁴⁵ sun shading ⁸³⁵ screen ¹⁴³⁸
theaterdetuyter.nl	Theater De Tuyter	Theater De Tuyter is a community center and theater in Krimpen aan den IJssel offering a diverse program including theater, music, and film, and providing a stage for local artists and initiatives.	Institutions → Cultural Institutions ⁴⁷⁵	theater ²⁵⁴⁴ ticket ²⁷⁸⁵ newsletter ⁶⁵⁰⁴ performance ⁷⁵⁸⁶ community ⁷⁹³¹
pophop.nl	PopHop Dutch Craft Beer	The website of POPHOP Dutch Craft Beer presents a selection of craft beers in combination with music, emphasizing the pairing of beer and music.	Music → Genres ¹⁷⁵² Beverages → Beer ¹⁰⁹⁵	packs ⁵⁶ playlist ²³¹ beer ²⁸⁸⁷ shop ⁶⁴⁸³ music ¹³¹⁷⁰	Lingewaard → Bemmel ⁵⁰⁹
sportsexposure.nl	Sports Exposure	Sports Exposure is a specialist providing businesses with the opportunity to realize TV advertising during sporting events.	Sports & Entertainment → Sports Marketing ⁹² Displays → LED Screens ¹⁵	advertising board ⁶⁸ eredivisie ⁸⁰	Zwolle → City Center ³⁴
smilekappers.nl	Smile Kappers	Smile Kappers is a salon chain offering haircuts, colors, and treatments for men and women in various locations.	Salons → Traditional Hair Salons ³⁶⁹	olaplex ⁴⁰ haircut ¹¹⁵⁸ hair ³⁰¹⁴ color ⁴¹⁵⁹ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	South-Holland → Zwijndrecht ¹⁴⁵⁵
dedenekampgids.nl	Gemeente Dinkelland	The website Denekamp Laatste Nieuws is a digital newspaper providing the latest news and updates about the municipality of Dinkelland and the surrounding area of Denekamp.	Transportation → Emergency Services ⁶³⁰	report ⁴⁵⁵¹ region ⁵⁴¹² vacancy ⁶⁵⁹⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Dinkelland → Denekamp ³⁷⁵
bitterweb.nl	Bitterweb	This website, Bitterweb, contains information about the Spirit football club from Ouderkerk aan den IJssel, including its youth selection, the family tree of the Bitter family, and a photography portfolio of the site's administrator.	Portals → Family Portals ³⁶ Football → Amateur Football ⁷⁵⁷	family tree ⁴⁴⁸ football club ⁶⁰³ family ⁶⁴⁶² photography ⁹⁵⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
droomvluchtslaapcomfort.nl	Droomvlucht Slaapcomfort	Droomvlucht Slaapcomfort is a bedding store in the Rotterdam region offering a wide range of beds, boxsprings, and accessories.	Beds → Boxsprings ²²⁹	boxsprings ¹⁵⁵ mattress ⁸⁹⁹ bed ¹³⁸⁴ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷	Westerkwartier → Zevenhuizen ⁴⁶⁰
welzijnvoorvoeten.nl	Welzijnvoorvoeten	The website of Welzijnvoorvoeten is an online platform for a medical pedicure practice specializing in the treatment of nail problems and foot care for at-risk feet, such as those with diabetes, rheumatoid arthritis, or vascular issues.	Specialty Medicine → Podologists ¹³²⁹	nail problems ¹² fungal nail ³⁸ orthosis ⁴⁹ treatment ²¹²⁰³
lunchroomleuk.nl	Lunchroom Leuk	Lunchroom Leuk is a lunchroom located on the Maas River in Krimpen a/d IJssel, situated on the former Hollandia grounds and offering a charming atmosphere with views of the river and the Brienenoord Bridge, with a terrace and fireplace.	Water → Rivers ¹⁸⁰ Bars & Pubs → Casual Dining ²¹⁷	lunchroom ³¹² view ¹⁰⁴⁵ terrace ⁴⁸⁴⁷	Rotterdam → IJsselmonde ¹⁸⁴
hoflandbv.nl	Hofland B.V.	Hofland Automaterialen is a wholesale supplier that provides car dealerships with a wide range of automotive materials and related products through a delivery service.	Urban Delivery → Delivery Service ¹⁵ Automotive → Automotive Supplies ¹²	delivery service ²³⁶ dealership ²⁹² part ⁵⁰⁴⁴ assortment ⁷⁷⁹⁹	Hoeksche Waard → Westmaas ⁶⁵
louistinner.nl	Reizende Boekhandel Louis Tinner	The Reizende Boekhandel Louis Tinner website offers the purchase and sale of second-hand and antique books, primarily through book markets in the Netherlands and online via various platforms.	Books → Secondhand Books ³⁴ Local Events → Markets ¹⁰⁹⁷	online sales ¹⁶ genre ⁵⁰¹ market ²⁷⁷² collection ⁷⁵⁶⁶ book ¹¹³⁹⁶	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
autorijschoolgoedegebuure.nl	Autorijschool Goedegebuure	Autorijschool Goedegebuure offers driving lessons and theory courses for obtaining a driver’s license in the Nieuwerkerk aan den IJssel region and surrounding areas.	Driver’s License → Theory ³³³	driver’s license ⁴³⁸ theory ⁹⁵⁶ exam ²¹²⁰ driving lessons ²⁴⁵³ course ¹⁴⁷²⁸	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
jptechniek.nl	JP Techniek	JP Techniek provides a comprehensive security concept, from advice to long-term guidance, offering services and products in the field of security and electrical engineering.	Security Systems → Security Technology ³⁹⁹ Industry → Industrial ¹⁹⁸⁷	safe ⁸⁹ security ⁶⁶⁵⁵ installation ¹³⁷⁴²	Gilze and Rijen → Rijen ⁴⁹³
trouwdorpderijp.nl	Trouwdorp De Rijp	The website of Trouwdorp De Rijp offers a complete approach to organizing weddings in Alkmaar and the surrounding area, including locations, attire, catering, and entertainment.	Water Travel → Boat Tours ⁶⁴⁰ Weddings → Wedding Planning ⁶⁷⁷	attire ¹⁷ wedding planner ¹³⁸ catering ⁶⁴⁵⁶ photography ⁹⁵⁰³	Edam-Volendam → Oosthuizen ⁹⁷
ijskrimpen.nl	IJSKrimpen	IJs Krimpen is an ice cream parlor that has been selling artisanal ice cream, bubble tea, coffee, and baked goods for twelve years, offering information and news to visitors.	Ice Cream → Ice Cream Parlors ⁵²¹ Ice Cream → Ice Cream Manufacturers ⁴⁵	cannoli ²⁵ bubble tea ¹⁵³ ice cream ¹⁰⁰⁰ opening hours ²⁹⁵³ coffee ³⁸³⁸
hansbroere.nl	Hoveniersbedrijf Hans Broere	The website of Hoveniersbedrijf Hans Broere showcases services and products related to garden maintenance, green roofs, corporate gardens, and spas.	Energy & Sustainability → Green Services ²⁶³ Sustainability → Green Spaces ¹²³⁵	green roof ²¹⁷ spa ³⁵⁵ garden ¹³¹²⁹
pknkrimpen.nl	Protestant Church of Krimpen aan den IJssel	The website of the Protestant Church of Krimpen aan den IJssel provides information about the four constituent congregations, as well as organizational details, agendas, news, and downloads.	Protestantism → Churches ¹⁰⁰⁹	downloads ¹⁵² congregation ³⁰² agenda ⁴³⁷⁴ region ⁵⁴¹² news ¹⁵²⁹³
egkrimpen.nl	Evangelische Gemeente Krimpen	The website of the Evangelical Church Krimpen provides information about the community, its activities, services, and events, including news, sermons, and children's and youth work.	Protestant Churches → Evangelical ⁵⁵² Protestantism → Baptist ²⁴⁵	baptism ⁵⁴ sermons ¹⁵⁶ gathering ³⁹⁴ church ³⁴³⁹ news ¹⁵²⁹³
elektricienkrimpenaandenijssel.nl	Elektricien Krimpen aan den IJssel	Elektricien Krimpen aan den IJssel is an electrician company operating in the Krimpen aan den IJssel region, specializing in emergency services and reliable installations.	Lighting & Electrical → Utilities ³⁸⁸ Energy → Electricity ⁷¹²	electrician ⁸¹⁹ task ¹⁵⁰⁷ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶
wsvdehollandscheijssel.nl	WSV de Hollandsche IJssel	The website of WSV de Hollandsche IJssel provides information about the marina, membership, history, photos, events, and contact details.	Boating → Harbors ²⁵² Boating → Marinas ⁸²⁵	watersport association ¹⁵ harbour ²⁹ berth ³⁴¹ marina ⁴⁸⁷ news ¹⁵²⁹³	South-Holland → Dordrecht ⁴⁵³¹
kooronomatopee.nl	Vocal Ensemble Onomatopee	The Vocal Ensemble Onomatopee website showcases the repertoire, upcoming performances, and contact information of an enthusiastic singing ensemble.	Film → Production Companies ⁴⁰⁶	footage ⁴⁸ ensemble ⁵⁴⁶ repertoire ²⁴⁹⁷ arrangement ³¹⁰⁴ concert ⁴⁴⁰⁹ performance ⁷⁵⁸⁶	Krimpenerwaard → Bergambacht ³⁰³
hoog500.nl	Hoog500 B.V.	The website hoog500 provides overviews, information, and news about the tallest buildings in the Netherlands, including lists and graphs.	Architecture → Architectural Services ¹⁰⁰⁶ Sustainable Building → Construction Projects ⁸²³	height ⁷⁰ graph ¹⁰⁴ updates ²⁰⁰ list ⁵⁷⁵ buildings ⁸⁹⁸	Zaanstad → Zaandam ²⁷⁴⁰
janvanwijnen.nl	Schildersbedrijf Jan van Wijnen BV	Schildersbedrijf Jan van Wijnen is a painting company with a long tradition that offers various painting and glasswork services, as well as maintenance contracts.	Personal & Household → Handyman Services ⁵⁷⁶	maintenance plan ⁸⁷ glasswork ¹⁶⁰ staff ³⁴⁰⁵ paint ⁸⁷⁴⁷
tckrimpen.nl	T.C. Krimpen	The website of Tennisclub Krimpen provides information about the club, its activities, membership options, and news.	Sport Facility → Tennis ²⁰⁷⁸	tennis ⁸³⁶ youth ³¹²⁶ competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹
foodchoice.nl	FoodChoice	The website of Irene Salverda Krimpen den IJssel is an online practice for a dietitian and lifestyle coach specializing in nutritional advice and guidance for various health issues, including gastrointestinal diseases, oncology, obesity, and the elderly.	Medicine → Oncology ²³⁰ Nutrition → Diets ⁹⁵¹	oncology ¹³⁰ nutritional advice ³¹⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
zwemschoolturbo.nl	Zwemschool Turbo	Zwemschool Turbo provides swimming lessons for children, emphasizing safety and enjoyment.	Water Activity → Swimming ¹⁴⁰² Sports & Fitness → Sports Training ⁷¹¹	swimming instructor ²⁰ swimming diploma ³⁷ swimming lesson ³⁹³ child ¹¹⁵⁶⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
abs-verhuur.nl	ABS-VERHUUR	ABS-VERHUUR is a rental company that provides a wide range of machinery and equipment, and is part of the ROROKA group.	Logistics & Transportation → Rental Companies ⁴¹⁴	compressor ²³⁴ forklift ⁴⁴⁷ groundwork ¹³⁴⁸ rental ⁷²⁵⁷
scholacantorumisala.nl	Schola Cantorum Isala	The Schola Cantorum Isala is a men's choir dedicated to preserving and promoting Gregorian chant.	Choral → Choir ¹⁸⁴² Protestantism → Churches ¹⁰⁰⁹	gregorian chant ¹¹ generation ¹⁵⁶ ceremony ⁸²⁴ choir ³¹²³ church ³⁴³⁹ music ¹³¹⁷⁰	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
huismuziekkrimpenerwaard.nl	Huismuziek Krimpenerwaard	Huismuziek Krimpenerwaard organizes musical activities for amateur musicians in the region of Krimpen aan den IJssel and surrounding areas.	Events & Venues → Amateur Music ¹⁵ Context ¹⁶¹³⁹⁴	playgroup ³⁸ ensemble ⁵⁴⁶ concert ⁴⁴⁰⁹ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹
oncocapelle.nl	Oncologienetwerk Capelle Krimpen Rotterdam	The website oncocapelle.nl presents a network of paramedical, psychological, and psychosocial care providers who collaboratively deliver oncological care in the region of Capelle aan den IJssel, Krimpen aan den IJssel, and Rotterdam.	Specialty Medicine → Cancer Care ⁹⁷	care provider ¹⁰⁰ oncology ¹³⁰ map ⁸⁰¹ region ⁵⁴¹²	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
baljonmakelaars.nl	Baljon Makelaars	Baljon Makelaars is a real estate agency specializing in the sale, purchase, and rental of homes and new developments in the Rotterdam and surrounding area.	Property Valuation & Appraisal → Appraisers ³¹⁵	appraisal ¹⁴⁸⁸ sale ⁵⁹³⁰ rental ⁷²⁵⁷ home ⁷⁹⁷⁶	Lansingerland → Berkel and Rodenrijs ⁹²⁹
tiobv.nl	TIO B.V.	TIO B.V. is a company specializing in the design, manufacture, and supply of noise control, exhaust, and air systems, including silencers and related components.	Manufacturing & Industrial → Engineering ³⁹¹⁹ Industry → Environmental Services ³⁸⁸	pressure vessel ¹³ exhaust system ⁵⁰ drawings ¹³²⁹ engineering ¹⁴⁶⁸
volwerkcleaning.nl	Volwerkcleaning	Volwerkcleaning is a cleaning company with 40 years of experience providing professional cleaning services and supplies.	Personal & Household → Household Services ¹⁰⁵⁰	staff ³⁴⁰⁵ cleaning ⁴⁵⁶⁷ property ⁷⁴⁰⁶ quote ¹²⁸⁶³
vanleeuwenlogistics.nl	Van Leeuwen Logistics BV	The website of Van Leeuwen Logistics presents the services of a logistics company, focusing on distribution, transport, and warehousing, and provides information about quality marks and vacancies.	Logistics → Warehouse Operations ⁷³⁹ Logistics → Transportation ¹¹⁰²	load ¹³⁶ europe ²⁸⁹ warehousing ⁴⁰⁸ distribution ¹⁰¹¹ vehicle ³⁷⁴³ transport ⁶¹⁰⁵
rosslovell.nl	Ross Lovell	The Ross Lovell website presents a location in Krimpen aan den IJssel that offers catering and facilities for various occasions, including weddings, parties and meetings.	Parks & Gardens → Public Space ⁴⁸	wedding ⁴²⁵⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹
immolab.nl	Immolab	Immolab provides professional microbiological testing, risk analyses, and management plans, specifically focused on legionella prevention, water quality, and air testing.	Nature Conservation → Water Management ¹¹³⁸ Insurance & Risk → Risk Management ¹⁰⁶⁰	management plan ²⁹ legionella ⁷³ risk analysis ²¹⁷
opwegmetdeander.nl	Op weg met de ander	Op weg met de ander is a Christian association dedicated to supporting people with disabilities and their families, focusing on finding suitable living locations and providing support and connection.	Religious Organizations → Protestant Organizations ¹¹⁴ Special Needs & Support → Support ²⁰⁰⁶	disability ⁵⁹⁴ magazine ²¹⁸² connection ⁴⁰⁰⁷ housing ⁴³⁷⁸ community ⁷⁹³¹	Zwartewaterland → Genemuiden ⁴⁰⁵
onemovement.nl	One Movement	One Movement provides freerun lessons and workshops for children in Rotterdam, Krimpen aan den IJssel, and Bergschenhoek, with the goal of enhancing the children's physical and mental resilience.	Childcare → Recreation ²⁹ Arts & Culture → Dance ²⁶⁸⁷	freerunning ⁴⁶ resilience ¹⁰⁹¹ trainer ¹⁹⁶⁶ lesson ⁵¹⁵⁴ community ⁷⁹³¹ child ¹¹⁵⁶⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
vorminbeeld.nl	Vorm in Beeld Carla van Gisbergen	The website of Carla van Gisbergen showcases her work as a visual artist, including her paintings, workshops, and an initiative for day care for people with disabilities. It also highlights her participation in various exhibitions and collaborations.	Painting → Individual Artists ⁶⁶⁸ Galleries & Exhibitions → Exhibitions ¹⁰⁸³	artworks ⁴⁶⁰ daycare ¹³⁶⁵ paintings ³⁹⁰⁷ exhibition ⁵³³² workshop ¹⁹³²⁵	Tilburg → Old South ⁷²
kdokrimpen.nl	KDO Krimpen a/d IJssel	The website of KDO Krimpen is an information resource and platform for members and potential members of the gymnastics and turn club, providing details on course offerings, events, news, membership, and volunteer opportunities.	Sports Clubs → Gymnastics ⁴⁸¹	turn ²²⁶ gymnastics ⁵⁰² annual report ⁸⁷⁷ dance ¹⁸³⁴ schedule ²⁶²⁴ membership ¹⁰⁴⁴²
groeneveldbrillen.nl	Groeneveld Brillen & Contactlenzen	Groeneveld Brillen & Contactlenzen is an optician with locations that sells eyeglasses, contact lenses, and sunglasses and provides advice.	Specialty Medicine → Optometry ⁵³⁹ Services → Opticians ⁵⁵¹	eyeglasses ⁴³⁷ sunglasses ⁵¹⁶ contact lenses ⁵³⁸ frames ²⁵⁵⁶ brand ¹⁷⁷³⁷	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
gmf-luchtkanalen.nl	Goudriaan Metaalwarenfabriek	The website of Goudriaan Metaalwarenfabriek presents the company's services as a specialist in the production of spiral pipes and fittings for air handling systems.	Home Improvement → HVAC Systems ⁷⁷³ Installation & Repair → Ventilation ⁸⁵⁹	air duct ⁶⁶ fittings ¹³⁰ production ⁴⁵⁸²
rudolfpeter.nl	Rudolf Peter Fashion Store	The website of Rudolf Peter Fashion Store offers a wide range of men's and women's fashion, including specific collections for small and large sizes, as well as accessories such as shoes and jeans. The store also offers appointments and personal styling services.	Fashion & Lifestyle → Television Programs ⁵⁶ Fashion → Men’s Fashion ⁶⁹⁰	men’s fashion ¹² women's fashion ¹⁰⁵ fashion ²²¹² store ³⁹⁰¹ collection ⁷⁵⁶⁶
brookland.nl	Brookland	The website of Brookland presents projects for the (re)development, purchase, and sale of shopping centers, residential complexes, and parking garages.	Real Estate → Residential Real Estate ⁶³ Real Estate → Commercial Property ¹⁸⁴⁰	rental apartment ²⁰ retail space ⁸⁶ parking garage ¹⁷⁵ shopping center ⁴⁹¹	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
wonenaandeoudewerf.nl	TW3	The website of Wonen aan De Oude Werf presents a new construction project in Krimpen aan den IJssel, called De Oude Werf, featuring various types of homes, including the Dijkhuis, the Scheepshuis, the Kraanhuis and the Pakhuis, and a communal garden.	Commercial Property → Retail Space ¹⁰⁷ Context ¹⁶¹³⁹⁴	courtyard ²⁰⁶ parking space ²⁹⁴ floor plan ³⁹⁴ sale ⁵⁹³⁰ home ⁷⁹⁷⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
centrumlevensvragenrotterdam.nl	Centrum voor Levensvragen Rotterdam & omstreken	The Centrum voor Levensvragen Rotterdam & omstreken provides spiritual care and support to residents and professionals with questions about life and meaning.	Palliative & End-Of-Life Care → Spiritual Care ⁸⁶ Social Services → Welfare ¹⁰⁰¹	spiritual care ³⁴ meetings ¹⁰¹¹ professionals ¹⁹⁶⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
veenweidenkrimpenerwaard.nl	Veenweiden Krimpenerwaard	The Veenweiden Krimpenerwaard website provides information about a project focused on strengthening the peat meadow landscape in the Krimpenerwaard through the realization of 2.250 hectares of additional nature, with the participation of farmers, private landowners, the government, and partners.	Planning & Development → Spatial Planning ⁸⁸⁹ Legal & Permits → Building Permits ⁴³	permits ⁶⁴³ contractor ¹⁰³⁹ nature ⁹⁰⁹⁴	Krimpenerwaard → Gouderak ¹⁰³
frenckenscholl.nl	Frencken Scholl Architecten	Frencken Scholl Architecten is an architecture firm based in Maastricht that works on various projects, including education, housing, healthcare, and renovation.	Urban Planning → Urban Development ³⁷⁸	building ³²⁰⁴ school ⁷⁸⁵⁶ interior ⁸⁰⁹³ collaboration ¹⁶⁰³⁶ design ²⁷²⁰²	Kapelle → Wemeldinge ¹¹⁸
vtvdeamateur.nl	VTV De Amateur	VTV De Amateur is a community gardening association providing information and services to members and potential tenants of allotment plots.	Gardening → Allotments ¹¹⁵ Gardening → Community Gardens ³⁹³	allotment ⁴⁸ membership fee ⁶⁵ waste management ⁸¹ shed ⁶³⁰ plot ¹⁰⁵¹
kryolan.nl	Kryolan Nederland	The website of Kryolan Nederland offers professional make-up for various sectors, including beauty, television, film, theater, and special effects. The shop in Krimpen aan den IJssel and Rotterdam also sells products and services for makeup artists and stylists.	Cosmetics & Skincare → Cosmetics ¹¹²² Beauty → Makeup ¹²⁴⁸	special effects ⁴¹ makeup artist ¹²⁷ cosmetics ⁶⁴⁸ makeup ¹⁴⁷⁷ training ²⁸¹³³	South-Holland → Rotterdam ²⁵⁰⁴⁸
schaik.nl	Van Schaik	Van Schaik is an automotive dealership offering new and used cars from brands such as Toyota and Suzuki, with a workshop and financing options.	Automotive Maintenance → Vehicle Inspection ¹¹⁰²	used car ⁸²⁵ lease ¹⁵⁹⁵ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵ appointment ¹³⁵¹⁰	Krimpenerwaard → Schoonhoven ⁵⁴⁴
breevaartpersoneel.nl	Breevaart Personeel	Breevaart Personeel is a recruitment agency specializing in placing personnel in various industries and sectors.	Work → Job Search ⁹⁶⁰	personnel ¹⁰⁸⁴ recruitment ²⁰¹⁵ vacancy ⁶⁵⁹⁸ collaboration ¹⁶⁰³⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
readme.nl	ReadMe	The ReadMe website showcases services related to clear and creative wayfinding, focused on improving orientation and experience in various buildings and locations, including libraries, schools, and care centers.	Architecture → Urban Planning ¹⁴⁶⁵	signage ⁸³⁸ buildings ⁸⁹⁸ vision ¹⁸⁸²	Zeeland → Goes ¹⁸⁹⁹
krimpenwijzer.nl	KrimpenWijzer	KrimpenWijzer is an online information portal and service point for residents of Krimpen aan den IJssel, focused on various areas of life such as care, well-being, parenting, housing, finances, and volunteering.	Financial Services → Advice ¹⁰⁰³ Context ¹⁶¹³⁹⁴	wellbeing ²⁶²⁰ care ¹²³³⁸ news ¹⁵²⁹³
hartclass.nl	Hartclass B.V.	Hartclass is a specialist in solar panel cleaning and offers a professional service for businesses.	Energy & Sustainability → Energy Consulting ⁸⁸³ Home → Installation & Repair ³²⁴¹	pv ¹⁰ yield ²⁹² cleaning ⁴⁵⁶⁷ solar panels ⁴⁷⁰¹ quote ¹²⁸⁶³	Netherlands → Utrecht ⁴⁸⁹⁰¹
nomwijkkrimpen.nl	NOM-Wijk Krimpen	The website presents a collective private contractor (CPO) called NOM-Wijk Krimpen, which is building sustainable homes in Krimpen aan den IJssel.	Social Issues → Social Organization ¹³³¹⁵ Construction & Maintenance → Procurement ⁵⁶⁷	collective ²⁵⁶ architect ⁶⁰⁹ apartment ⁵⁰⁸⁸ construction ⁷⁴²¹ home ⁷⁹⁷⁶ garden ¹³¹²⁹	Alkmaar → Oudorp ³⁴⁵
gezondheidswinkel-libra.nl	Gezongheidswinkel Libra	Gezongheidswinkel Libra is a health store located in the Rotterdam region offering vitamins, supplements, natural cosmetics, and homeopathy.	Supplements → Vitamins ²⁶⁹ Products → Natural Products ¹⁸⁴	vitamin ⁴⁶⁹ cosmetics ⁶⁴⁸	South-Holland → Dordrecht ⁴⁵³¹
libertasinvestments.nl	Libertas Investments	Libertas Investments is a real estate-specialized service provider offering a selection of existing funds, with the option to invest in new funds through Opti-Investments.	Investing → Real Estate Investing ⁷⁰⁷ Social Organization → Funds ³⁵	management team ³⁵ returns ³⁴⁰ investor ³⁷² fund ¹⁰⁶³ risk ²⁸⁹⁶ real estate ⁴⁹⁸¹
wsprijnmondijsselgemeenten.nl	Werkcentrum Rijnmond	The website of Werkcentrum Rijnmond and IJsselgemeenten provides information about personnel placement, labor market guidance, and initiatives focused on finding work for vulnerable groups.	Social Services → Youth Care ⁵⁶⁶ Economy → Employment & Labor ⁶⁰⁵⁹	trajectory ⁵⁵⁶ workplace ¹⁰⁴⁶ subsidy ²⁶⁴⁹ youth ³¹²⁶ staff ³⁴⁰⁵ childcare ³⁵¹²	Katwijk → Katwijk aan Zee ⁶¹⁶
juwelier-oorebeek.nl	Juweliershuis Ed Oorebeek	The website of Juweliershuis Ed Oorebeek showcases a wide range of watches, jewelry, and wedding rings, both online via a webshop and in the shop located in Krimpen aan den IJssel.	Accessories → Jewelry ³⁵¹⁷	wedding rings ²⁸¹ watch ¹¹⁶⁶ jewelry ⁴⁵⁹⁹ shop ⁶⁴⁸³ webshop ⁸⁶⁴⁸ brand ¹⁷⁷³⁷
krimpenduurzaam.nl	Gemeente Krimpen aan den IJssel	The website Krimpen Duurzaam provides information, inspiration, and opportunities for residents of Krimpen aan den IJssel to take sustainable actions, such as saving energy, sorting waste, and getting involved in climate adaptation.	Living → Sustainable Living ⁸¹⁷	waste ¹³¹² subsidy ²⁶⁴⁹ resident ³²⁴⁵ energy ⁹⁰⁷⁵ sustainability ¹⁸⁴⁵¹ event ⁴⁵¹⁹⁹
vidainterieur.nl	Vidainterieur	Vidainterieur is a company specializing in interior design, design, and the realization of custom interiors, catering to both private residences and commercial offices.	Project Management → Interior Projects ¹⁹ Commercial Properties → Office Design ¹³⁵	wishes ²⁷¹⁷ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²	South-Holland → Rotterdam ²⁵⁰⁴⁸
breedveldstaal.nl	Breedveld Staal	Breedveld Staal is a steel supplier and dealer that provides steel and metal products to various industries.	Metals & Fabrication → Metals ⁴⁸⁶	steel ¹¹⁷⁷ industry ¹⁷⁸⁰ transport ⁶¹⁰⁵	Eersel → Knegsel ¹³⁵⁹
marketingkaart.nl	Marketingkaart	The website, Marketingkaart, provides an overview of 500+ Dutch marketing professionals and helps users quickly find a marketing agency that meets their needs.	Online Marketing → Affiliate Marketing ²⁹⁹ Business Development → Business Marketing ⁶¹⁴	marketer ⁴² compare ⁵⁸² agency ⁹⁴⁴ marketing ⁷¹⁰⁷ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
reuzekeus.nl	Speelotheek Reuzekeus	The website of Speelotheek Reuzekeus in Krimpen aan den IJssel presents a toy library with a wide assortment of toys and board games, featuring a special morning session for children aged 0 to 4 years.	Games → Board Games ⁴¹⁶ Family Fun → Family Activities ¹⁴⁹³	board game ³⁰⁶ toy ²²⁹⁵
accountantkaart.nl	Accountantkaart	The website Accountantkaart presents a top 500 of Dutch accountants.	Apps → Business Apps ¹⁰ Accounting → Service Providers ⁶³	accountant ⁶¹¹ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
leefbaarcapelle.nl	Leefbaar Capelle	Leefbaar Capelle is a political party dedicated to improving the municipality of Cappelle aan den IJssel, focusing on residents, businesses, and sustainability.	Political Parties → VVD ¹⁸⁷ Local Politics → Municipal Council ⁴⁸⁴	position ⁸⁷⁵ resident ³²⁴⁵ municipality ⁶⁸³⁷ news ¹⁵²⁹³
admincares.nl	AdminCares	AdminCares is a company offering administrative, tax, and real estate settlement services, primarily focused on seniors and bereaved families.	Law → Legal Information ²³³ Legal → Inheritance Law ⁵⁴⁵	bereaved ²⁹¹ financial ⁸⁵⁵ tax ²¹⁰⁰ real estate ⁴⁹⁸¹ administration ⁶⁵⁸⁷ foundation ⁶⁶⁷⁸	South-Holland → Rotterdam ²⁵⁰⁴⁸
go-ctp.nl	CTP Industrial Maintenance	The website of CTP Industrial Maintenance is a resource for industrial organizations seeking technical services. It provides information about the company’s services, projects, and certifications.	Maintenance & Services → Machine Maintenance ²⁶² Machinery & Repair → Machinery ¹⁰⁴⁵	preventative maintenance ¹³ technical service ⁷² machinery ⁵¹⁹ quote ¹²⁸⁶³ installation ¹³⁷⁴²	South-Holland → Ridderkerk ¹³³⁵
nieuwbouw-alblasserdam.nl	Nieuwbouw Alblasserdam	The website Nieuwbouw Alblasserdam provides an overview of all new construction projects, purchase and rental homes in the Alblasserdam region, with the possibility to subscribe for updates and create a personal profile.	Property Location & Neighborhood → Property ⁶⁹⁵	new construction project ⁷⁹ account ⁵⁷⁸¹ home ⁷⁹⁷⁶	South-Holland → Hendrik-Ido-Ambacht ⁶⁶⁴
jongerentheaterquint.nl	Jongentheater Quint	Jongerentheater Quint is a foundation that organizes theater performances and workshops for young people in the region of Capelle aan den IJssel and surrounding areas.	Theater → Drama ¹⁸⁵ Theater → Youth Theater ²⁰⁴	freedom ⁸⁴⁸ young people ¹⁰⁴⁵ theater ²⁵⁴⁴ performance ⁷⁵⁸⁶ workshop ¹⁹³²⁵	Rotterdam → IJsselmonde ¹⁸⁴
de-candyshop.nl	CandyShop	The CandyShop website aims to provide a selection of sweets and confectionery products across 11 locations in the Netherlands.	Entertainment → Leisure Activities ³³⁸ Chocolate & Sweets → Confectionery ¹¹⁹	sweets ²²⁹ bonbons ³²⁹ cake ¹⁷³⁰ promotion ²⁰⁶² store ³⁹⁰¹ price ⁸³²⁸	Zwijndrecht → Bloemenbuurt H-L ²⁶
bvkrimpen.nl	Basketbal Vereniging Krimpen	The website of Basketbal Vereniging Krimpen (BVK) provides information about the basketball association, its teams, training schedules, events, and membership details.	Basketball → Basketball Associations ¹⁴	basketball ¹⁷⁵ match ³⁴⁷¹ membership ¹⁰⁴⁴² training ²⁸¹³³	South-Holland → Krimpenerwaard ¹⁸⁴⁰
nater.nl	Nater	The website of Nater is a specialist in providing fire suppression systems, gas and liquid systems, pumps and related components, with over 25 years of experience in developing and maintaining safe system solutions.	Industrial → Industrial Automation ¹⁰⁴²	fire suppression system ¹⁷ pump ⁶²⁵ component ⁷¹⁴
remofashion.nl	Remo Fashion 2.0	Remo Fashion is an online store specializing in women's and girls' clothing, as well as boys' clothing, with its own label and an outlet.	Clothing → Men’s Clothing ¹⁰⁰⁸	outlet ²³⁵ jacket ⁶²³ shirt ⁶⁶⁹ dresses ⁷⁷⁸ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵
kinderboerderij-kleinboveneind.nl	KIBO	Kinderboerderij Klein Boveneind is a children's farm located in Krimpen aan den IJssel, offering visitors the opportunity to meet animals, participate in activities, and rent the hall.	Farms & Farm Businesses → Children’s Farms ²⁰ Animal Welfare → Animal Shelters ³²⁶	rent ⁹⁸¹ playground ¹⁰⁸⁸ hall ¹⁷⁸⁶ animal ²⁹⁰⁸
t-direct.nl	Schiphol Taxi Direct Zuid-Holland	The Schiphol Taxi Direct Zuid-Holland website provides an online tool for calculating taxi fares to and from Schiphol Airport, and facilitates online bookings for luxury airport taxis from various regions of South Holland and other cities in the Netherlands.	Taxi & Ride Services → Taxi ¹⁰⁶² Taxi & Ride Services → Personal Transportation ¹⁹⁵	fare ⁸⁶ bookings ⁵²³ airport ⁷⁸⁹ driver ¹⁸³² taxi ²⁰⁹⁰ transportation ²⁸⁵¹	Rotterdam → Hoek van Holland ⁵⁴⁰
mobilefashioncity.nl	Mobile Fashion City	Mobile Fashion City provides a smartphone and tablet repair service at competitive prices, offering a wide range of brands and repair options.	Computer → Computer Accessories ¹²² Repair → Equipment Repair ²⁶	device ⁶⁹⁸ tablet ⁹⁹⁸ phone ¹¹⁶³ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Nissewaard → Spijkenisse ¹⁴³³
devogelvrienden.nl	The Vogelvrienden	The Vogelvrienden is a bird association based in Krimpen a/d IJssel that brings bird lovers together.	Birdwatching → Bird Clubs ¹⁶ Animals → Birds ⁴⁷⁰	bird association ²⁶ agenda ⁴³⁷⁴ exhibition ⁵³³² nature ⁹⁰⁹⁴ member ¹⁰¹⁵⁴
vanherkvastgoed.nl	Van Herk Vastgoed	Van Herk Vastgoed is a real estate company specializing in investing and developing various types of property.	Investing → Real Estate Investing ⁷⁰⁷ Commercial Property → Retail Space ¹⁰⁷	property development ¹⁴ industrial hall ¹⁶ residential property ³³ retail space ⁸⁶ office space ⁷⁷³ real estate ⁴⁹⁸¹
ckzvandaag.nl	CKZ Vandaag	CKZ Vandaag is a news website providing information and tips about mobility, sustainability and trends, with a focus on the Capelle aan den IJssel and Krimpen regions.	Neighborhood Focus → Neighborhoods ¹⁰²⁸ Government & Administration → Government Organizations ¹⁰⁰²	noise ¹⁰⁸ bus ⁸⁹⁴ politics ¹²⁵⁹ housing ⁴³⁷⁸ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
rooscarpaccio.nl	Roos Carpaccio	Roos Carpaccio is a company that supplies artisanal carpaccio to the foodservice and retail sectors.	Hospitality → Suppliers ¹⁰⁵⁷ Dairy & Cheese → Delicatessens ⁶¹⁷	carpaccio ⁴⁷ distribution ¹⁰¹¹ fish ¹¹²¹ meat ²⁰⁵⁵	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
capelsevvd.nl	Capelse VVD	The Capelse VVD is a local political party dedicated to representing the interests of the municipality of Capelle aan den IJssel.	Political Parties → Dutch Political Parties ¹⁵⁸ Municipalities → Capelle Aan Den IJssel ²¹	vvd ⁷⁵ council member ¹⁰⁷ faction ¹³² policy ²¹⁴⁹ municipality ⁶⁸³⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
aannemersbedrijfklapwijk.nl	Klapwijk Aannemersbedrijf	Klapwijk Aannemersbedrijf is a construction company specializing in new construction, extensions, renovations, maintenance, and remodeling of residential and commercial buildings.	Construction Companies → Additions ⁴⁵⁸ Building & Materials → Carpentry & Joinery ⁸³⁰	extension ¹⁹⁴¹ new construction ²⁶⁷² roofing ²⁸⁰⁶ tile ²⁸⁶⁹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
iphonereparatiekrimpenaandenijssel.nl	N/A	The website offers iPhone and tablet repair services in Krimpen aan den IJssel, emphasizing professional and skilled service.	Mobile Phones → Refurbished Phones ⁵⁷	ipad ⁴⁰⁴ iphone ⁶⁶² phone ¹¹⁶³ screen ¹⁴³⁸ battery ¹⁷⁵¹ repair ¹⁴⁵⁷⁶
speeljebeter.nl	Speel je Beter	Speel je Beter is a website for child occupational therapy, focused on treating motor development delays in children.	Podology → Orthopedics ¹⁵²⁵ Early Years → Early Childhood Education ¹³⁴⁵	reflex ⁴⁶ play ⁶³¹ movement ²³⁰⁴ therapy ⁷⁴⁴⁸ practice ⁹⁰⁸⁹ child ¹¹⁵⁶⁶
mapack.nl	Mapack BV	The website of Mapack BV offers packaging solutions including boxes, bags, films and accessories, focusing on custom solutions and fast delivery times for various industries, with a focus on sustainable solutions such as bio-based bags and CO2-neutral cups.	Logistics → Packaging ¹⁰⁹⁴	box ¹⁹⁸² packaging ²²³⁶ bag ²³⁹⁹ film ³⁰⁰⁷ sustainability ¹⁸⁴⁵¹	Rotterdam → Prins Alexander ⁴³²
sebakerk.nl	Gereformeerde Gemeente Krimpen aan den IJssel	The website of the Sebakerk serves as an information center for the Gereformeerde Gemeente Krimpen aan den IJssel, providing details about church services, events, and community initiatives.	Reformed → Church Organization ¹⁵⁵	choir ³¹²³ church ³⁴³⁹ community ⁷⁹³¹ event ⁴⁵¹⁹⁹
stemvankrimpen.nl	Stem van Krimpen	The website Stem van Krimpen presents the party’s election program and positions for local municipal elections in Krimpen aan den IJssel, aiming to engage citizens in decision-making and represent their interests.	Political Parties → CDA ³⁶ Local Politics → Municipal Elections ⁸⁸	election program ⁸⁵ faction ¹³² citizen ¹⁸⁴ politics ¹²⁵⁹ municipality ⁶⁸³⁷
bellamilano.nl	Bella Milano	The website of Bella Milano is an Italian restaurant located in Krimpen aan den IJssel offering food, wine and catering services, with the option for reservations and takeout.	Food Delivery → Italian Restaurant ¹⁰⁴⁰ Bars & Pubs → Casual Dining ²¹⁷	live music ¹²⁹ reservation ³³⁷³ dish ⁵⁹³⁶ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵
voedselbankkrimpenaandenijssel.nl	Food Bank Lokaal	The website of the Food Bank Krimpen aan den IJssel provides information on applying for food assistance for individuals facing temporary financial difficulties and encourages donations and volunteer work.	Social Issues → Poverty Prevention ⁵⁵	food safety ¹³² food package ¹⁵⁰ donation ⁵¹¹⁰ volunteer ⁸³⁶⁷ collaboration ¹⁶⁰³⁶
de-ijsselmannen.nl	Shantykoor De IJsselmannen	The website of Shantykoor De IJsselmannen aims to inform visitors about the choir’s activities, members, upcoming events, and the possibility to become a sponsor.	Choir → Shanty Choir ⁴⁵ Ensemble → Vocal Groups ²²⁵	cd ⁵⁷⁴ repertoire ²⁴⁹⁷ photo ⁷⁷⁷⁸ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
elmart.nl	OnlineGallery	The website of Elma Hoste showcases her paintings and artwork, along with information about her exhibitions and interviews.	Knowledge → Arts ³⁷⁷²⁵	art ³⁸⁵⁶ paintings ³⁹⁰⁷ exhibition ⁵³³² nature ⁹⁰⁹⁴	Krimpenerwaard → Schoonhoven ⁵⁴⁴
eetcafeambiance.nl	Eetcafé Ambiance	Eetcafé Ambiance in Krimpen a/d Ijssel offers an online ordering system for spareribs and other dishes, with options for delivery and pickup.	Cafes → Eateries ⁸²	spareribs ²¹³ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶
okkrimpen.nl	Ondernemerskring Krimpen aan den IJssel	The Ondernemerskring Krimpen aan den IJssel is an association for entrepreneurs in Krimpen aan den IJssel, focusing on promoting and improving the business climate and representing the interests of its members with the municipality and other organizations.	Associations & Groups → Business Associations ¹⁰¹⁸	advocacy ³⁵⁷ economy ⁶⁸² app ⁴⁵⁹⁵ association ⁸⁵⁶² member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹
autohoppercapelle.nl	Autohopper Roggeveen	The Autohopper Roggeveen website offers car rental, minibus rental, and moving truck rental services in the Capelle aan den IJssel, Rotterdam, and surrounding areas. Its goal is to facilitate the rental of vehicles for short and long periods.	Moving → Moving Companies ⁸³⁵ Rental Services → Car Rental ¹⁰⁴⁷	moving truck ³⁷ minibus ⁷⁴ rental ⁷²⁵⁷ price ⁸³²⁸ car ¹⁰⁸⁶⁵	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
bsk-bouw.nl	BSK Prefabs B.V.	BSK Prefabs B.V. is a company specializing in sustainable building and renovation with high quality, focusing on prefabricated building methods.	Construction Industry & Methods → Sustainable Construction ¹³⁹¹ Fabrication & Production → Prefabrication ⁴¹²	prefab ⁴¹⁷ building ³²⁰⁴ renovation ¹³⁸⁴⁹	Hoeksche Waard → Oud-Beijerland ⁶⁶⁵
architectenbureau-cladder.nl	Architectenbureau Cladder	The website of Architectenbureau Cladder showcases projects designed by architect Frans Cladder, with a focus on both the aesthetic design and functional layout of buildings.	Urban Planning → Urban Development ³⁷⁸ Building & Construction → Sustainable Building ¹⁰⁰⁴	buildings ⁸⁹⁸ plot ¹⁰⁵¹ environment ⁴⁸⁷³ design ²⁷²⁰²	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
ijsseldijkkerk.nl	IJsseldijkkerk	The website of the IJsseldijkkerk provides information about the Protestant parish in Krimpen aan den IJssel, including service times, news, activities, and contact details.	Reformed → Church Organization ¹⁵⁵ Catholic → Parishes ⁴⁵⁷	pastoral care ¹²² youth work ¹⁷¹ parish ³⁵³ church service ⁸⁷⁹ news ¹⁵²⁹³
wingerdkrimpen.nl	PKN gemeente de Wingerd	The website of PKN gemeente de Wingerd provides information about the community, its activities, services, news, and contact details.	Protestant Churches → Congregations ³⁰⁴ Local Communities → Religious Communities ²⁷⁰	liturgy ²³⁸ church service ⁸⁷⁹ agenda ⁴³⁷⁴ community ⁷⁹³¹ news ¹⁵²⁹³
nieuwbouw-krimpen-aan-den-ijssel.nl	Nieuwbouw Krimpen aan den IJssel	The website Nieuwbouw Krimpen aan den IJssel provides an overview of new construction projects, buy- and rental homes in the region of Krimpen aan den IJssel, with a focus on presenting the complete housing supply and informing users about future developments.	Hobbies → Model Building ¹⁰⁰⁷ Context ¹⁶¹³⁹⁴	supply ⁹⁶¹ housing ⁴³⁷⁸ region ⁵⁴¹² account ⁵⁷⁸¹ home ⁷⁹⁷⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
belbus-krimpen.nl	Stichting Belbus	The Belbus is a foundation that transports seniors (60+) in the municipality of Krimpen aan den IJssel to prevent social isolation and encourage participation in social activities.	Bus Services → Public Transportation ⁷⁸² Community → Social Issues & Welfare ²⁸¹⁵⁹	seniors ⁹⁰⁴ transportation ²⁸⁵¹ municipality ⁶⁸³⁷ membership ¹⁰⁴⁴²
govatech.nl	Govatech	Govatech is a company that designs, produces and installs air ducts, constructions and sheet metal for various sectors.	Manufacturing → Industrial Manufacturing ¹⁵⁰ Installation & Repair → Ventilation ⁸⁵⁹	air duct ⁶⁶ sheet metal ²¹⁵ construction ⁷⁴²¹	Bergen op Zoom → Halsteren ²⁹⁸
rokerijdezalm.nl	Rokerij de Zalm	The website of Rokerij de Zalm presents an artisanal salmon roastery with a long tradition and focus on quality, specializing in the smoking of Norwegian and Scottish salmon for wholesalers and the hospitality industry.	Fish → Smoked Fish ³⁹	roastery ⁵⁵ salmon ¹⁸⁵ flavor ¹⁰³²
kompaskrimpen.nl	Stichting PCPO Capelle-Krimpen	PCB Het Kompas is a Protestant Christian primary school in Krimpen aan den IJssel that welcomes all children and focuses on respect, empathy, and responsibility.	Elementary Schools → Christian Primary Schools ³⁴² Childcare → Preschool ⁵¹²	english ¹⁸⁵ vision ¹⁸⁸² parent ⁴³¹⁸ school ⁷⁸⁵⁶
regioapotheekijsselland.nl	Regioapotheek IJsselland B.V.	Regioapotheek IJsselland BV is a 24-hour polyclinic and service pharmacy that provides medications and advice.	Hospital & Acute Services → Hospitals ⁷³⁵ Pharmaceuticals & Medical Products → Pharmacies ¹⁰²⁹	service pharmacy ¹⁵ hospital ⁵⁶⁰ prescription ⁸⁵⁹ medication ¹¹⁶⁴	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
bqfinance.nl	BQFinance	BQFinance is a bookkeeping and tax advisory firm offering services to both individuals and businesses in the Capelle aan den IJssel and Rotterdam area.	Government & Legal → Tax ¹³²²	allowance ¹⁶³ return ⁹⁰⁹ payroll ¹⁸²³ tax ²¹⁰⁰ administration ⁶⁵⁸⁷	Nissewaard → Spijkenisse ¹⁴³³
robstolkconcepts.nl	Rob Stolk Concepts	The website Rob Stolk Concepts showcases a diverse portfolio of creative and strategic services, including design, graphic design, writing, and photography, focused on creating authorship and branding for individuals and organizations. It also contains stories and news articles.	Literature → Non-Fiction ⁵¹⁹ Media & Communication → Writing Assistance ²¹	writing ¹⁵⁰⁴ branding ⁴⁶¹⁴ photography ⁹⁵⁰³ news ¹⁵²⁹³ design ²⁷²⁰²	's-Hertogenbosch → Oud-Empel ¹³
nieuwbouw-capelle-aan-den-ijssel.nl	Nieuwbouw Capelle aan den IJssel	The website Nieuwbouw Capelle aan den IJssel provides a comprehensive overview of new construction projects, for sale and rental properties in Capelle aan den IJssel and surrounding areas, with a focus on informing potential buyers and renters.	Municipalities → Capelle Aan Den IJssel ²¹ Property Valuation & Appraisal → Property Market ¹⁴³	rental property ²¹¹ listings ⁵²⁵ region ⁵⁴¹² property ⁷⁴⁰⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
fysiovitaalkrimpen.nl	FysioVitaal Krimpen	FysioVitaal Krimpen is a physiotherapy practice offering various therapies and rehabilitation programs for sports and general mobility issues.	Physiotherapy → Sports Physiotherapy ⁷⁴⁷	sports physiotherapy ⁴³⁶ injury ⁵⁴³ rehabilitation ¹⁵¹² movement ²³⁰⁴ physiotherapy ⁴⁶⁸⁸ goal ⁴⁹⁷⁴
nieuwbouw-ridderkerk.nl	Nieuwbouw Ridderkerk	The website Nieuwbouw Ridderkerk provides information to potential buyers and renters about all new construction projects, purchase and rental properties in the municipality of Ridderkerk and the surrounding region.	Municipalities → Capelle Aan Den IJssel ²¹	new construction project ⁷⁹ rental property ²¹¹ region ⁵⁴¹² account ⁵⁷⁸¹ property ⁷⁴⁰⁶	South-Holland → Hendrik-Ido-Ambacht ⁶⁶⁴
fysiostabiel.nl	Fysiostabiel	The website of Fysiostabiel, a practice of Riekje Wiersma, Psychosomatic Physical Therapist, provides information about psychosomatic physiotherapy, Nordic Walking, and a course focused on personal discovery.	Walking → Nordic Walking ²⁵ Body & Movement → Movement ⁹⁶⁷	psychosomatic physiotherapy ²⁶ nordic walking ⁴² body awareness ⁸⁸ book ¹¹³⁹⁶ course ¹⁴⁷²⁸	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
sepia.nl	SDV Sepia	SDV Sepia is a sports club offering activities centered around diving, snorkeling, and underwater hockey.	Water Activity → Diving ⁵⁰⁵ Sports & Fitness → Sports Training ⁷¹¹	underwater hockey ¹⁴ snorkel ⁵² diving ⁴⁵⁹ member ¹⁰¹⁵⁴ event ⁴⁵¹⁹⁹
makebeauty.nl	Kapsalon Make Beauty	Kapsalon Make Beauty is a salon in Krimpen aan den IJssel offering hair styling, makeup, eyelash extensions, and hair designs, with an emphasis on personalized attention and fashionable trends.	Makeup → Makeup Artists ⁷³³ Cosmetics & Aesthetic → Personal Care ¹⁰⁰¹	lashes ¹¹⁵ hairstyling ⁴⁸² hairstyle ⁸¹² makeup ¹⁴⁷⁷
haptonomie-gouda.nl	Christine Bak	The website provides information about haptotherapy and haptonomic pregnancy guidance offered by Christine Bak in Gouda, focusing on restoring balance and guiding through pregnancy and loss.	Therapy → Haptotherapy ⁶³³ Health → Pregnancy & Childbirth ⁴²²²	haptonomy ¹²¹ haptotherapy ⁴⁴⁴ loss ⁷⁴⁰ pregnancy ²⁷³⁹	Krimpenerwaard → Bergambacht ³⁰³
comfortmakelaardij.nl	Comfort Makelaardij	Comfort Makelaardij is a real estate agency operating in Krimpen a/d IJssel and the Rotterdam region, aiming to assist private clients with the purchase, sale, and valuation of properties.	Property Sales → Buying a House ⁸⁷²	agency ⁹⁴⁴ plan ²⁵⁶⁶ valuation ²⁶⁹⁷ wishes ²⁷¹⁷ region ⁵⁴¹² property ⁷⁴⁰⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
skkweb.nl	SKK Zomerkampen	The website of SKK Zomerkampen Krimpen a/d IJssel presents and promotes summer camps for children, teenagers, and young people from the region of Krimpen a/d IJssel, organized by the Stichting Kampwerk Krimpen.	Camping → Children’s Camps ²⁰	camp ²⁴⁶⁶ youth ³¹²⁶ volunteer ⁸³⁶⁷	Land van Cuijk → Mill ³⁴²
energietoeslagaanvragen.nl	Energietoeslagaanvragen.nl	The website provides information about energy allowance in Dutch municipalities.	Social Services → Assistance Services ⁶²⁷ Legal → Rights ²⁸	application ³³⁷⁷ municipality ⁶⁸³⁷	Amsterdam → Weesp ¹⁰⁰⁵
tobekind.nl	Kinderopvang To Be Kind	Kinderopvang To Be Kind provides childcare services for children aged 0 to 13 years, including childcare, after-school care and preschool, with a Christian focus and multiple locations.	Childcare → Daycare Centers ⁹⁸⁷	baby spa ³⁵ bso ³³⁵ preschool ⁴⁹⁵ childcare ³⁵¹² parent ⁴³¹⁸	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
maaskant-interieurbouw.nl	Maaskant Meubel- en interieurbouw	Maaskant Meubel- en interieurbouw is a company that offers high-quality, custom-made furniture and interior solutions for both private and business clients.	Interior → Furniture ⁷⁴⁵⁴	interior design ¹⁸⁰² interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ workshop ¹⁹³²⁵
boxinggoes.nl	Boxing Goes	Boxing Goes is a recognized boxing school in Goes offering diverse training sessions for men, women, and youth, focusing on classic boxing.	Sports & Fitness → Sports Training ⁷¹¹ Combat → Boxing ⁴²²	box ¹⁹⁸² technique ²¹⁵⁷ child ¹¹⁵⁶⁶ training ²⁸¹³³	Zeeland → Goes ¹⁸⁹⁹
tipkrimpenaandenijssel.nl	Gemeente Krimpen aan den IJssel	TipKrimpenaandenIJssel is a digital panel that informs residents of Krimpen aan den IJssel about current topics and offers them the opportunity to share their opinions.	Social Issues → Participation ¹⁰²³ Social Media → Online Forums ¹⁰³	opinion ⁴¹⁷ questionnaire ⁶⁶⁶ topic ¹²³⁸ idea ²³⁶⁷ municipality ⁶⁸³⁷
ahdeblock.nl	Visgilde	This website belongs to the store Visgilde in Krimpen Aan Den Ijssel and provides information about the store, vacancies and news.	Food → Supermarkets & Grocery ³⁵⁶⁸ Context ¹⁶¹³⁹⁴	albert heijn ²³ opening hours ²⁹⁵³ store ³⁹⁰¹ sustainability ¹⁸⁴⁵¹
ngv-rotterdam.nl	NGV Rotterdam and surroundings	The website of the NGV Rotterdam and surroundings provides information about the genealogy branch’s activities, offers genealogical resources, and promotes meetings.	Local History → Dutch History ¹⁰⁶⁷ Social Sciences → Genealogy & Family History ¹⁴⁰³	branch ²⁶⁸ family tree ⁴⁴⁸ genealogy ⁵⁴³ meetings ¹⁰¹¹ publication ²⁰¹⁸ newsletter ⁶⁵⁰⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
streetmma.nl	Sterker & Strakker Personal Training	The website streetmma.nl provides information about Street-MMA, a martial arts system, and other martial arts such as kickboxing, self-defense, and street boxing, as well as information on personal training in the Rotterdam, Krimpen, and Capelle aan den IJssel area.	Self-Defense → Krav Maga ⁴⁹	krav maga ⁸⁶ martial arts ²¹⁶ personal training ¹²⁷¹ fitness ²²⁵¹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
despellerie.nl	De Spellerie	The website De Spellerie sells board games, with a particular focus on games that are beneficial for people with dementia or other brain problems, and educational games for all ages.	Games → Board Games ⁴¹⁶ Care → Elderly ⁸²	educational ⁶³ dementia ⁶⁷⁴ memory ¹⁶⁴¹ game ²⁸⁰⁷	South-Holland → The Hague ¹⁹⁸⁹⁸
aa-plus.nl	AA+ Design Bureau B.V.	The website of AA+ Design Bureau B.V. presents their services as an architectural design and construction company, specializing in the creation of luxury villas in Gooische and Kempische styles, and offering complete building guidance and concept development.	Accommodation → Villas ¹⁰¹⁸	villa ¹³⁵¹ customization ¹⁷²³ concept ³³³⁸ design ²⁷²⁰²	South-Holland → Ridderkerk ¹³³⁵
servicepuntkrimpen.nl	Servicepoint Krimpen	Servicepoint Krimpen is a shop that sells parts and accessories for white and brown goods appliances and provides advice.	Household & Cleaning → Household Goods ¹⁶⁴² Business Services → Customer Service ¹⁴⁵¹	appliance ⁹⁵⁶ part ⁵⁰⁴⁴ accessories ¹²⁹⁷⁵
zuidwestlogistiek.nl	ZUIDWEST Logistiek	ZUIDWEST Logistiek is a full-service logistics company providing transport and logistics services, both domestically and internationally, with a focus on urgent deliveries and various industries.	Logistics → Warehouse Operations ⁷³⁹ International Transportation → Europe ¹¹³	distribution ¹⁰¹¹ fleet ¹³⁵¹ storage ²⁴⁴⁶ logistics ³²⁵⁷ transport ⁶¹⁰⁵	Almere → Almere City ⁹³⁴
svmakelaardij.nl	Swijnenburg & Valk Makelaardij	The website of Swijnenburg and Valk Makelaardij provides a platform for buying and selling real estate, with a focus on the Krimpenerwaard and Capelle region. The purpose is to inform and connect potential buyers and sellers with suitable properties.	Business Strategy → Business Sales ¹¹	buyer ²³³ transaction ⁶¹³ valuation ²⁶⁹⁷ property ⁷⁴⁰⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
bellaricci.nl	Bella Ricci	Bella Ricci is a hair salon and beauty salon offering hair care, beauty treatments, and photography services.	Makeup → Makeup Artists ⁷³³	hairwork ⁷⁵ beauty specialist ¹⁸⁸ stylist ⁴⁷⁶ beauty salon ⁵⁴⁷ photoshoot ¹⁰¹⁸ hair ³⁰¹⁴	Westerkwartier → Zevenhuizen ⁴⁶⁰
jbgeluid.nl	JB Geluidstechniek	The website of JB – Geluidstechniek presents the services of Jurgen Brouwer as a sound technician, freelance consultant, and PA rental company.	Audio → Sound Technology ¹⁶⁸ Music → Recordings & Production ¹⁰⁷²	sound technician ³¹ freelancer ⁸⁷⁷ record ¹⁰⁹⁸ studio ⁵⁴⁶⁵	South-Holland → Rotterdam ²⁵⁰⁴⁸
peron.nl	Péron Liftadvies	The website offers strategic procurement management and project management services focused on lifts and other installations, particularly for housing corporations and VvE's.	Homeownership & Management → Housing Corporations ⁴²⁶ Engineering → Mechanical Engineering ⁷³⁷	procurement management ¹⁰ maintenance management ¹¹ lift ⁴⁴⁵ project management ³⁴²³ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	South-Holland → Leiden ⁷⁰⁸⁹
pampassteak.nl	Pampas Grill & Tapas	The Pampas Grill & Tapas website presents the Argentinian restaurant Pampas Steakhouse in Krimpen aan den IJssel, providing information about the menu, reservations, and contact details.	Fast Food → Grill Restaurant ¹²⁹	tapas ⁴⁶⁵ buffet ¹⁷⁴⁷ meat ²⁰⁵⁵ reservation ³³⁷³ catering ⁶⁴⁵⁶ restaurant ¹¹²¹⁵
deeigenwijzekat.nl	Kattenoppas Nederland	The website of ‘De EigenWijze Kat’ (now ‘Kattenoppas Nederland’) offers a professional and reliable cat sitting service at clients’ homes, focusing on caring for cats in their familiar environment during their owners’ vacations or absences.	Animal Care → Cat Care ¹³²	cat sitting ²¹ territory ²⁶ cat ¹⁵⁷⁸ vacation ⁴²³⁴ region ⁵⁴¹²	Haarlemmermeer → Vijfhuizen ²²⁶
youngladieschoir.nl	Young Ladies Choir Hadassah	The website of Young Ladies Choir Hadassah provides information about the choir, including news, concerts, rehearsals, and a guestbook.	Choir → Amateur Choir ¹⁶⁰ Choir → Men’s Choir ²¹²	piano ⁸²⁰ rehearsal ¹⁶³⁹ repertoire ²⁴⁹⁷ choir ³¹²³ concert ⁴⁴⁰⁹
basschoutenwitgoedreparatie.nl	Bas Schouten Witgoed Reparatie	The website of Bas Schouten Witgoed Reparatie is a professional website of a white goods repair technician offering services in the IJsselmonde region. The website provides information about the repair of various white goods and the possibility of telephone advice or on-site visits.	Household Appliances → White Goods ¹³² Context ¹⁶¹³⁹⁴	white goods ⁶³ dryer ²⁰³ dishwasher ³²⁴ refrigerator ⁴⁷⁵ washing machine ⁴⁸⁷ repair ¹⁴⁵⁷⁶	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
impromaniacs.nl	Impromaniacs	The website of Impromaniacs provides information about their improvisation theater group, their events, and their competitions.	Theater → Theater Groups ⁶⁷³ Theater → Improvisation ¹⁵⁹	improvisation ²⁹⁸ competition ⁴⁷⁵⁹ performance ⁷⁵⁸⁶ event ⁴⁵¹⁹⁹	Rotterdam → Center ³⁸²
winkelcentrumdekorf.nl	Winkelcentrum De Korf	Winkelcentrum De Korf is a shopping center serving the residents of Krimpen aan den IJssel and surrounding areas.	Commerce → Shopping Centers ¹⁰⁰¹ Art & Culture → Festive Events ¹⁵	groceries ³⁵⁸ shopping center ⁴⁹¹ shop ⁶⁴⁸³ event ⁴⁵¹⁹⁹
devriespiping.nl	De Vries Piping	De Vries Piping is a supplier and repairer of piping systems for various industries, including shipbuilding and offshore.	Shipbuilding → Components ²³ Manufacturing & Industrial → Industrial Services ⁴⁰⁰	prefabrication ⁶⁸ offshore ¹²⁴ shipbuilding ¹⁴⁸ manufacturing ³⁹⁶ pipe ⁶⁹⁵
rietveldtimmerbedrijf.nl	Rietveld timber and interior company	The website of Rietveld timber and interior company presents the services of a carpenter who carries out quality work for both indoor and outdoor renovations, including the installation of frames, skylights, kitchens and bathrooms.	Renovation → Roof Renovation ⁴³⁰ Garden → Garden Sheds ⁴⁰⁰	carpenter ²²⁰ skylight ⁹⁶⁶ carpentry ²²¹⁸ frames ²⁵⁵⁶ bathroom ³⁷⁸⁴ kitchen ⁶⁴⁴³
krimpeninbeeld.nl	Gemeente Krimpen aan den IJssel	This website offers a comprehensive collection of thousands of photos of Krimpen aan den IJssel throughout the years, compiled and published by the Historical Circle Krimpen and the Municipality of Krimpen aan den IJssel.	Internet → Archives ⁴²²	landscape ²⁶⁰⁹ municipality ⁶⁸³⁷ photo ⁷⁷⁷⁸
boroadvies.nl	Boro Advies & Consultancy	Boro Advies & Consultancy is a consulting firm that supports businesses in achieving their business goals.	Real Estate → Business Finance ³⁴⁶	consulting ³⁶³⁹ growth ⁴⁰⁵⁴ relationship ⁴²⁰⁵ strategy ⁹³⁷⁹ network ¹¹¹²³	South-Holland → Rotterdam ²⁵⁰⁴⁸
spreijtaxaties.nl	Spreij Taxaties	Spreij Taxaties is a valuation company that prepares expert valuation reports for homes.	Property Valuation & Appraisal → Appraisers ³¹⁵	valuation ²⁶⁹⁷ office ²⁸⁹⁸ report ⁴⁵⁵¹ home ⁷⁹⁷⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
vanspeijkwonen.nl	Van Speijk Wonen	Van Speijk Wonen is a company located in Capelle aan den IJssel specializing in flooring and staircase renovations.	Renovation → Flooring Renovation ²⁰⁸ Renovation → Stair Renovation ³⁵⁰	staircase renovation ⁴⁸ carpet ⁸⁴⁰ floor ⁴⁷⁸¹ showroom ⁴⁸⁸³	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
fysiotherapieheiszwolf.nl	Fysiotherapie Heiszwolf	Fysiotherapie Heiszwolf is a physiotherapy practice located in Capelle a/d IJssel offering a variety of treatments and rehabilitation programs.	Medicine → Physiotherapy ²³⁷²	sports physiotherapy ⁴³⁶ manual therapy ¹³²⁰ rehabilitation ¹⁵¹² physiotherapy ⁴⁶⁸⁸ complaint ⁶⁴⁷⁹	Schouwen-Duiveland → Nieuwerkerk ¹¹⁰
atlasvloeren.nl	Atlas Vloeren	Atlas Vloeren is a flooring store that offers customized flooring solutions, including laminate, PVC, and herringbone flooring, and offers stair renovation services.	Renovation → Flooring Renovation ²⁰⁸	herringbone ⁴⁰ customized ⁴²⁶ laminate ⁶⁴⁰ floor ⁴⁷⁸¹ renovation ¹³⁸⁴⁹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
werkenbijcvo.nl	CVO	The website of CVO presents job vacancies and information about working for the organization, with particular attention to opportunities for teachers and trainees in education.	Higher Learning → Educational Institutions ¹⁰⁴⁹	job vacancies ¹²⁴¹ teacher ²⁸⁹⁰ student ⁷⁶²³ school ⁷⁸⁵⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
kringloopkrimpen.nl	KringloopKrimpen	The KringloopKrimpen website is a second-hand shop that sells second-hand items, accepts donations and consignments, and provides information about the shop, opening hours, and the team.	Social Organization → Children’s Organizations ⁴⁶⁷ Retail & Commerce → Second-Hand Shops ¹¹⁰	second-hand shop ⁴³ consignment ⁵⁴ item ¹¹²⁵ opening hours ²⁹⁵³ donation ⁵¹¹⁰
apothekersrijnmond.nl	Combination of Apothecaries Association Rijnmond (CAVR)	The website of the Combination of Apothecaries Association Rijnmond (CAVR) aims to support and represent the interests of pharmacists in the Rijnmond region.	Pharmaceuticals & Medical Products → Pharmacies ¹⁰²⁹	pharmacist ⁶² region ⁵⁴¹² member ¹⁰¹⁵⁴ communication ¹⁰¹⁶² collaboration ¹⁶⁰³⁶	South-Holland → Barendrecht ¹⁶⁵³
rudolfsteinerschoolkrimpen.nl	Rudolf Steinerschool Krimpen aan den IJssel	The website of the Rudolf Steinerschool Krimpen a/d IJssel provides information about the school, its vision, enrollment, and other relevant details.	Primary Education → Free Schools ⁶⁴ Higher Learning → Educational Institutions ¹⁰⁴⁹	after school care ²⁰² playground ¹⁰⁸⁸ school ⁷⁸⁵⁶ child ¹¹⁵⁶⁶ education ¹³⁴⁷¹
dewegwijzerkrimpen.nl	Stichting PCPO	Basisschool De Wegwijzer is an open Christian primary school in Krimpen aan den IJssel that prioritizes the development of the child.	Language → English ¹⁶¹ Higher Learning → Educational Institutions ¹⁰⁴⁹	english ¹⁸⁵ childcare ³⁵¹² parent ⁴³¹⁸ school ⁷⁸⁵⁶
gallery62.nl	Gallery62	Gallery62 is a home furnishing store located in Krimpen aan den IJssel that offers a wide range of products including flooring, window coverings, wallpaper, and furniture. They are also the exclusive Lampe Berger dealer in the area.	Decor & Furnishings → Home Stores ⁹³²	home furnishing ¹¹³ window coverings ¹²¹³ wallpaper ¹⁷⁵⁶ furniture ⁸⁷⁵¹ brand ¹⁷⁷³⁷
verloskundigenkrimpen.nl	Verloskundigen IJssel & Lek	Verloskundigen IJssel & Lek is a midwifery practice that supports pregnant women and their partners throughout pregnancy, childbirth, and postpartum care.	Pregnancy & Childbirth → Midwifery ⁶¹⁹	contraception ¹⁵⁸ postpartum ⁴⁶⁴ midwife ⁵⁵³ childbirth ⁸⁹⁴ pregnancy ²⁷³⁹ care ¹²³³⁸	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
samenvoorlevenmetkanker.nl	Camino, de IJssel and PATIO, VitaMotionNow	This website promotes a joint bike tour organized by various centers for people with and after cancer, aiming to strengthen the connection between these centers and raise awareness.	Catalonia → Barcelona ⁴³ Social Issues → Social Organization ¹³³¹⁵	bike tour ⁹⁷ center ¹¹¹⁵ participant ¹⁹³⁴ route ³⁴²⁵ coffee ³⁸³⁸	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
dita-scheepstransport.nl	V.O.F. Dita Scheepstransport	The website of V.O.F. Dita Scheepstransport presents the services of a shipping company that transports goods by water in the Benelux.	Marine & Watercraft → Water Transportation ⁴⁴⁶	transportation ²⁸⁵¹ quote ¹²⁸⁶³	South-Holland → Dordrecht ⁴⁵³¹
vanbemmelbouwconstructies.nl	Van Bemmel Advies Bouwconstructies VBA	Van Bemmel Advies Bouwconstructies is a construction advisory firm specializing in building structures and projects.	Construction Companies → Construction Contractors ⁵³⁶ Personal & Household → Other Services ¹²⁰	architect ⁶⁰⁹ contractor ¹⁰³⁹ construction ⁷⁴²¹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
autoservicedeolm.nl	Autoservice de Olm	Autoservice de Olm is a Eurorepar Car Service garage located in Krimpen aan den IJssel that offers maintenance, repair, and vehicle inspection services.	Automotive Maintenance → Vehicle Inspection ¹¹⁰² Road Services → Road Transport ⁴⁰⁰	towing ⁴² inspection ⁴²⁷⁹ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³
rioolserviceklapwijk.nl	Klapwijk Rioolservice	The website of Klapwijk Rioolservice offers drain services, including unclogging, repair, inspection, odor detection, preventative maintenance, new installation, and replacement of drainage systems, and informs visitors about potential misdirection and fraud within the drain cleaning sector.	Plumbing → Waste Water Management ¹⁴ Plumbing → Drainage ⁵⁷⁰	unclogging ²⁴⁴ drain ⁸⁸⁶ drainage ¹³²² vacancy ⁶⁵⁹⁸ quote ¹²⁸⁶³ repair ¹⁴⁵⁷⁶	Krimpenerwaard → Bergambacht ³⁰³
seegers-fournituren.nl	Seegers Fournituren	The website of Seegers Fournituren offers a wide range of haberdashery, both online and at markets, with a focus on sewing supplies and repairs.	Markets → Local Markets ¹⁵³ Commerce → Textile Trade ⁷⁴	sewing supplies ¹⁸ thread ¹⁰⁷ button ¹¹⁴ market ²⁷⁷² assortment ⁷⁷⁹⁹	Lansingerland → Berkel and Rodenrijs ⁹²⁹
kindertheateronwijz.nl	Christelijk Kindertheater Onwijz	The website of Christelijk Kindertheater Onwijz presents information about their Christian children's theater productions, the schedule of performances, and the possibility of booking the theater group.	Theater → Children’s ¹⁶⁸ Theater → Youth Theater ²⁰⁴	theater group ²²³ schedule ²⁶²⁴ church ³⁴³⁹ performance ⁷⁵⁸⁶	Woerden → Harmelen ³³⁵
banketceesveth.nl	Bakker Casteleijn	The website of Bakker Casteleijn announces the acquisition of the Cees Veth bakery and the further development of their pastry offerings.	Financial Management → Acquisitions ³⁰² Pastries & Baked Goods → Pastry ¹²¹⁰	brand name ²⁰ pastry ²⁰⁶ acquisition ⁴⁰⁸ bread ¹⁶²² store ³⁹⁰¹ shop ⁶⁴⁸³	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
pointzsports.nl	Pointz Sports	Pointz Sports provides tennis and padel lessons in the Krimpenerwaard region, with a focus on padel courses and clinics.	Tennis → Padel ⁸⁸⁰	padel ⁶⁰² tennis ⁸³⁶ trainer ¹⁹⁶⁶ course ¹⁴⁷²⁸ event ⁴⁵¹⁹⁹	South-Holland → Krimpenerwaard ¹⁸⁴⁰
verhuizenkrimpenaandenijssel.nl	N/A	This website offers a platform to receive cost-effective moving quotes from licensed movers in Krimpen aan den IJssel, where users can easily input data and receive a quote.	Moving → Movers ²⁷²	volume ¹⁶⁶ moving company ¹⁷⁸ mover ⁴⁶⁷ inventory ¹⁶¹³ quote ¹²⁸⁶³
mariposa-massage.nl	Mariposa-Massage	The website of Mariposa-Massage presents Ayurvedic relaxation massage and Pinda Sweda massage as methods to balance the body and mind, relieve pain, and restore energy circulation.	Massage → Ayurvedic Massage ¹²	pain ¹⁹¹⁹ body ³⁴⁹⁰ balance ⁴⁵⁸² salon ⁵⁵⁴¹ massage ⁷⁶⁴⁶ energy ⁹⁰⁷⁵
krimpenontmoet.nl	N/A	The website ‘Krimpen ontmoet!’ is a platform where residents, entrepreneurs, and employees of social organizations in Krimpen aan den IJssel can submit ideas for initiatives that bring the community together.	Social Issues → Community Development ³³⁰ Initiatives & Projects → Local Initiatives ¹⁰⁰¹	initiative ¹²⁹⁷ subsidy ²⁶⁴⁹ community ⁷⁹³¹ event ⁴⁵¹⁹⁹
padmosmakelaardij.nl	Padmos Makelaardij B.V.	Padmos Makelaardij is a real estate agency that sells, buys, and appraises properties in Krimpen aan den IJssel and surrounding areas.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Property Valuation & Appraisal → Regional Real Estate Agents ⁴⁵⁴	appraisal ¹⁴⁸⁸ purchase ²²¹² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
smitdakwerken-nh.nl	Smit Dakwerken-NH	The website of Smit Dakwerken-NH offers a wide range of roofing and repair services throughout the Netherlands, including roof insulation, renovation, and emergency repairs.	Heating → Fireplaces ⁵⁷⁸	chimney ⁵²³ roofing ²⁸⁰⁶ roof ³⁶⁶² inspection ⁴²⁷⁹ renovation ¹³⁸⁴⁹	Dijk en Waard → Heerhugowaard ²⁰¹¹
dewarijschool.nl	Dewa Rijschool	The website of Dewa Rijschool Vlaardingen offers driving lessons, theory courses, and information on obtaining a driver's license in the Rotterdam region and surrounding areas.	Driver’s License → Scooter License ¹⁰²	theory ⁹⁵⁶ license ¹²⁸⁸ driving lessons ²⁴⁵³ instructor ³¹²⁶ course ¹⁴⁷²⁸	Nissewaard → Spijkenisse ¹⁴³³
baytalnoerkrimpen.nl	Protestantse Kerken and Nederlandse Gereformeerde Immanuelkerk	Bayt al Noer is a meeting place for Arabic-speaking Christians and those interested in faith in Krimpen aan den IJssel and surrounding areas, where the Gospel is shared.	Religion → Protestantism ³¹⁷⁸ Immigrant & Cultural Groups → Immigrant Communities ¹⁷	christianity ⁷⁶ refugees ³⁴⁰ gospel ³⁴⁵ community ⁷⁹³¹
praktijkdelotus.nl	Praktijk De Lotus	Praktijk De Lotus is a wellness practice located in Krimpen aan den IJssel offering various services including yoga, mindfulness, lifestyle coaching, and artistic activities, focused on relaxation and wellbeing.	Physical → Strength Training ³⁶¹	lifestyle coaching ³³⁹ exercises ¹⁰⁵⁸ mindfulness ¹⁷⁸⁹ yoga ³⁷⁰⁴
folkertskaat.nl	Folkerts & Kaat	Accountantskantoor Folkerts & Kaat is an accounting firm that provides administrative and tax services to businesses and individuals.	Accounting → General Accounting ⁹³⁹ Government & Legal → Tax ¹³²²	annual financial statement ¹²⁵ business consulting ¹⁹⁸ payroll ¹⁸²³ tax ²¹⁰⁰ subsidy ²⁶⁴⁹ administration ⁶⁵⁸⁷
vanderendebv.nl	Bouw- en aannemingsbedrijf Van der Ende	The website of Bouw- en aannemingsbedrijf Van der Ende from Bergambacht presents the company as a comprehensive general contractor specializing in new construction, maintenance, and commercial construction, operating in the Randstad region and focused on delivering high-quality projects for various clients.	Architecture → Architectural Services ¹⁰⁰⁶ Project Management → Construction Management ¹⁰³⁸	housing corporation ⁴²⁴ new construction ²⁶⁷² maintenance ²⁰⁰⁹³	Krimpenerwaard → Bergambacht ³⁰³
seniorensocieteitdrunen.nl	Senior Society Drunen	This website is for the Drunen Senior Society, a platform for seniors in Drunen and surrounding areas to participate in various activities, events, and trips.	Social Organization → Senior Organizations ⁷⁵⁰ Wellness → Senior Travel ⁵⁹	kbo ²² trip ²⁰³² association ⁸⁵⁶² membership ¹⁰⁴⁴² event ⁴⁵¹⁹⁹	The Hague → Scheveningen ¹⁶²⁵
rijschoolwestergouwe.nl	Rijschool Westergouwe	Rijschool Westergouwe offers driving lessons and training in the Gouda region and surrounding areas.	Driver & Vehicle → Driver’s License ¹⁶²⁵	driving training ¹³ driver's license ¹²⁸³ driving lessons ²⁴⁵³ instructor ³¹²⁶ vehicle ³⁷⁴³	Zuidplas → Moordrecht ³³²
bouwbedrijfmashro.nl	Bouwbedrijf Mashro	Bouwbedrijf Mashro is an independent construction company specializing in residential construction, extensions, renovations, and project management in the region.	Construction Companies → Residential Construction ¹⁰¹³ Insulation → Insulation Companies ¹²⁴	construction project ⁷⁰¹ insulation ²⁴⁴⁸ house ⁸¹²¹ renovation ¹³⁸⁴⁹ collaboration ¹⁶⁰³⁶	Rotterdam → Prins Alexander ⁴³²
tpijsselland.nl	TP IJsselland	Tandartsenpraktijk IJsselland is a dental practice located in Krimpen a/d IJssel that provides high-quality and patient-centered dental care.	Dentistry → Private Practices ¹⁶	dentistry ⁶⁰⁶ dentist ²⁵¹⁴ patient ⁴⁰⁸² treatment ²¹²⁰³	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
energiekkrimpen.nl	Energiek Krimpen	The website of Energie k Krimpen describes an energy cooperative focused on the energy transition in Krimpen aan den IJssel.	Cooperatives → Energy Cooperatives ³¹⁵	energycooperative ¹⁶⁰ municipality ⁶⁸³⁷ energy ⁹⁰⁷⁵ membership ¹⁰⁴⁴² sustainability ¹⁸⁴⁵¹
hagendijkbouw.nl	Hagendijk Bouw	Hagendijk Bouw is a construction company that carries out home renovations and new construction projects in the Krimpen aan den IJssel region and surrounding areas.	Construction Companies → Additions ⁴⁵⁸ Building & Materials → Carpentry & Joinery ⁸³⁰	construction company ⁸²⁴ carpentry ²²¹⁸ new construction ²⁶⁷² home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
wolfjekids.nl	Wolfje kids conceptstore	The Wolfje Kids Conceptstore website is a shop where parents and children can find baby and children’s clothing from various well-known brands, with a focus on brands for children aged 0 to 10 years.	Clothing → Children’s Clothing ¹⁴⁶⁹ Gifts → Gift Cards ⁹⁸¹	children’s clothing ⁴⁵ baby clothing ³⁰⁹ gift card ⁵⁸² toy ²²⁹⁵ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷
totalphone.nl	Total Phone BV	The website of Total Phone BV is an online store where customers can purchase smartphones, accessories, and tablets from various brands, including Apple, Samsung, Oppo, Google, and Nokia. It also offers subscription plans, service, repair, and insurance.	Electronics & Components → Mobile Electronics ¹²	tablet ⁹⁹⁸ phone ¹¹⁶³ subscription ³²⁸⁷ accessories ¹²⁹⁷⁵ repair ¹⁴⁵⁷⁶	Bodegraven-Reeuwijk → Bodegraven ⁷⁴⁹
werkenbijvlr.nl	VLR	The website of VLR Accountants presents job vacancies and describes the accounting firm as an experienced and diverse organization with two locations in the Krimpenerwaard.	Business Software → Accounting Software ⁹⁸⁴	accounting firm ²⁵⁰ audit ⁶²² industry ¹⁷⁸⁰ vacancy ⁶⁵⁹⁸	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
kleinehuisdierenkliniek.nl	Evidensia Dierenklinieken B.V.	The Kleine Huisdieren Kliniek Krimpen offers primary veterinary care for companion animals.	Animals → Animal Care ¹⁸⁴⁹ Animals → Companion Animals ²³	dental ²⁵ vaccination ⁴⁹⁴ ultrasound ⁷⁶⁹ veterinarian ⁸⁶⁴ cat ¹⁵⁷⁸ dog ⁵⁴⁸³
dapperewolf.nl	Dappere Wolf	Dappere Wolf offers coaching with a therapy dog in the Krimpen aan den IJssel region, designed to assist children and adults struggling with emotions or behavior.	Childcare → Child Coaching ³⁴³	growth ⁴⁰⁵⁴ dog ⁵⁴⁸³ child ¹¹⁵⁶⁶ coach ²⁵⁸¹⁰
srspersoneel.nl	SRS Personnel	The SRS Personnel website is a recruitment agency specializing in temporary staffing and job postings across various sectors.	Work → Job Search ⁹⁶⁰ Human Resources → Personnel Management ⁵²⁰	turnover ⁸³ sector ¹³³² job ²⁷⁹⁵ staff ³⁴⁰⁵
baristahans.nl	Outdoor Adventure – Catering	The website of Outdoor Adventure – Catering offers coffee, snacks and catering services at various events and campsites in the region, especially around walking, cycling and bird watching.	Outdoor & Recreation → Outdoor Events ¹¹⁰ Recreation → Recreational Activities ⁶⁵	camp ²⁴⁶⁶ snack ²⁹¹⁶ coffee ³⁸³⁸ catering ⁶⁴⁵⁶ event ⁴⁵¹⁹⁹	Alphen aan den Rijn → Boskoop ⁶⁵²
sincofa.nl	Sincofa	Sincofa is a coating company with 35 years of experience specializing in providing high-quality plastic coatings for various industries.	Maintenance & Repair → Industrial Maintenance ⁷³² Retail & Commerce → Commerce ⁸²⁴⁴	ptfe ¹² corrosion ⁴⁹ coating ⁸⁰⁶ plastic ¹²³²
thuiszorg-info.nl	thuiszorg-info.nl	The website thuiszorg-info.nl is a platform designed to help users find the best home care provider, access information about home care services, and register for appropriate support. It offers a directory of home care providers, articles on home care topics, and a community for clients and providers.	Business & Industry → Business News ⁴⁶⁸	article ⁶⁰⁰⁰	Haarlemmermeer → Hoofddorp ²⁷³⁹
werkenbijsansidor.nl	Sansidor	The website of Sansidor is a job board seeking professionals for employment, specifically in the sectors of fire safety, water quality, air quality, infection prevention, electrical engineering and burner installation inspections.	Water & Environmental → Water Technology ¹⁹⁸ Technical Services → Technical ⁹⁵⁷	water quality ¹⁴⁵ fire safety ⁵⁸⁹ job ²⁷⁹⁵ inspection ⁴²⁷⁹ vacancy ⁶⁵⁹⁸	Gelderland → Ermelo ¹²⁰⁷
tielemanenco.nl	Tieleman & Co bv	Tieleman & Co is an electrical installation company specializing in the installation, maintenance, and inspection of electrical systems for residential and commercial clients.	Manufacturing & Industrial → Industrial Services ⁴⁰⁰	accreditation ¹⁸⁰ safety ⁵⁸¹⁹ installation ¹³⁷⁴²
ovkelektra.nl	OVKelektra	OVKelektra is an electrical installation company that provides services in Krimpen aan den IJssel and surrounding areas.	Energy → Electricity ⁷¹² Installation & Mounting → Installers ¹⁰⁰⁷	electrician ⁸¹⁹ heat ²¹⁸⁸ data ⁵⁸⁷² installation ¹³⁷⁴²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
dibotherm.nl	Dibotherm	The website of Dibotherm presents gevelisolatie (exterior insulation) services and information for individuals and businesses in the South Holland region, with the goal of improving the energy efficiency and appearance of buildings.	Technical Services → Maintenance Companies ⁵¹⁷ Insulation → Exterior Insulation ²⁰	facade plastering ¹¹ facade maintenance ⁸⁵ new construction ²⁶⁷² renovation ¹³⁸⁴⁹	Voorne aan Zee → Oostvoorne ²⁶⁰
armainfra.nl	Arma Infra B.V.	Arma Infra B.V. is a civil construction company providing various services in the Netherlands, including soil remediation, drainage and roadwork, and earthworks.	Environmental Technology → Soil Remediation ⁵⁸ Civil & Infrastructure → Earthworks ³⁷⁰	civil works ¹⁴ waste container ⁹⁹ soil remediation ¹⁴⁹ roadwork ¹⁵⁶ earthwork ⁴³⁵ drainage ¹³²²	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
jagtstoffeerderij.nl	Van der Jagt Stoffeerderij	Van der Jagt Stoffeerderij is a upholstery workshop specializing in restoring and renewing interiors of cars, furniture, boats, campers, and caravans.	Upholstery & Fabrics → Upholsterers ¹⁶⁵ Personal & Household → Household Services ¹⁰⁵⁰	upholstery ⁶⁷³ boat ²⁹⁸⁰ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ car ¹⁰⁸⁶⁵	Krimpenerwaard → Bergambacht ³⁰³
fysiotherapie-lek-yssel.nl	Fysiotherapie en Manuele therapie Lek & Yssel	Fysiotherapie en Manuele therapie Lek & Yssel is a practice located in Lekkerkerk and Krimpen aan den IJssel specializing in the treatment of complaints related to the musculoskeletal system.	Physiotherapy → Pediatric Physiotherapy ³²⁷	shockwave ⁹⁸ pelvic physiotherapy ¹⁹⁸ pediatric physiotherapy ²⁵⁸ ultrasound ⁷⁶⁹ manual therapy ¹³²⁰ physiotherapy ⁴⁶⁸⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
karpervissen.nl	Karpervissen.nl	Karpervissen.nl is an online magazine dedicated to carp fishing, providing articles, news, and videos on various aspects of the sport.	Water Management → Water Quality ⁵⁷ Fishing → Carp Fishing ¹²⁹	carp ⁹⁶ bait ¹⁴⁸ technique ²¹⁵⁷ water ²⁵⁰¹ news ¹⁵²⁹³	South-Holland → Rijswijk ²⁰⁵⁴
newtranstec.nl	New TransTec	The website of New TransTec showcases a selection of premium audio equipment from various brands, including Quad, Tannoy, VTL, Castle, and Trigon, and offers import services in the Benelux region.	Audio → Amplifiers ¹¹³	audio equipment ²⁰⁴ sound ¹⁶⁴⁹ brand ¹⁷⁷³⁷
autoschadedeijssel.nl	ASN Autoschade De IJssel	ASN Autoschade De IJssel is a specialized auto damage repair company with over 10 years of experience in repairing damage to all car brands, offering BOVAG-certified repairs with a four-year written warranty.	Car Care & Detailing → Detailing ⁹⁴¹	windshield repair ¹³ auto damage ⁴⁴ damage repair ³²⁶ vehicle ³⁷⁴³ warranty ⁴⁷⁰¹
hoveniersbedrijf-neeleman.nl	Hoveniersbedrijf Neeleman	The website of Hoveniersbedrijf Neeleman showcases the services of a landscaping company, specifically focused on garden design, landscaping, renovation and maintenance, and provides references and contact information.	Garden Maintenance → Gardeners ⁶⁸⁵ Civil & Infrastructure → Water Construction ¹²⁰	reference ³³² landscaping ¹⁵²⁹ garden ¹³¹²⁹ sustainability ¹⁸⁴⁵¹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
mrdakdekkerkrimpenaandenijssel.nl	Roofing Company Krimpen Aan Den IJssel	The website of Dakdekker Krimpen Aan Den IJssel offers roof repairs, inspections and renovation services in the municipality of Krimpen Aan Den IJssel and surrounding areas. The goal is to inform roof owners and provide assistance with roof problems, especially leaks and damage.	Roofing → Roof Repair ⁶⁴⁷	leak ¹²⁰⁴ roofing ²⁸⁰⁶ roof ³⁶⁶² inspection ⁴²⁷⁹ renovation ¹³⁸⁴⁹ repair ¹⁴⁵⁷⁶
dekkerkrimpen.nl	Garagebedrijf Dekker Dekker B.V.	The website of Autobedrijf Opel Dekker presents the company as an official Opel dealer, repair shop, and lease partner in Krimpen aan den IJssel, with a focus on personalized service and the offering of cars and maintenance.	Cars (Brands) → Opel ¹⁵ Repair → Garage ¹⁷⁷⁹	opel ⁶² lease ¹⁵⁹⁵ occasion ²⁰³⁶ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ workshop ¹⁹³²⁵
schooninhuis.nl	Schooninhuis	The website of Schooninhuis offers professional upholstery cleaning and stain removal services, targeting both private and business clients.	Cleaning Services → Carpet Cleaning ⁸⁴	sofas ³²² carpet ⁸⁴⁰ mattress ⁸⁹⁹ chair ¹²²³ cleaning ⁴⁵⁶⁷ furniture ⁸⁷⁵¹	Schagen → Tuitjenhorn ³⁸²
etcb.nl	ETC B	ETC B offers specialized training and education programs for skilled professionals, focusing on practical skills and career preparation.	Security & Surveillance → Security ³²⁵¹ Technical Services → Technical ⁹⁵⁷	locksmith ⁹¹⁹ security ⁶⁶⁵⁵ course ¹⁴⁷²⁸ training ²⁸¹³³
bloemsierkunstdevierjaargetijden.nl	Bloemsierkunst de Vier Jaargetijden	Bloemsierkunst de Vier Jaargetijden is a flower shop in Krimpen aan den IJssel specializing in floral arrangements and home accessories.	Commerce → Flower Retail ²⁵ Crafts → Floral Design ²⁴¹	floral arrangement ³⁴⁴ bouquet ¹¹⁴⁷ flowers ³²⁴⁸ home ⁷⁹⁷⁶ accessories ¹²⁹⁷⁵
gegovuurwerk.nl	Gego vuurwerk	Gego vuurwerk is a webshop selling fireworks, offering a wide range of products and advice.	Party Supplies → Fireworks ²⁵⁸ Retail & Commerce → Internet Retailers ⁷⁰	fireworks ⁴¹³ opening hours ²⁹⁵³ assortment ⁷⁷⁹⁹ webshop ⁸⁶⁴⁸ brand ¹⁷⁷³⁷
my-touch.nl	My Touch Beautysalon	The website of My Touch is an all-round beauty salon in Krimpen aan den IJssel offering a wide range of beauty treatments and workshops, with a special focus on bridal hairstyles and makeup.	Makeup → Makeup Artists ⁷³³	bridal hairstyle ¹³³ eyebrows ¹¹²⁷ makeup ¹⁴⁷⁷ salon ⁵⁵⁴¹ workshop ¹⁹³²⁵ treatment ²¹²⁰³
osteopathie-krimpenerwaard.nl	Osteopathie Krimpenerwaard	The website of Osteopathie Krimpenerwaard provides general information about osteopathy, treatments, fees, and reimbursement policies.	Physical Therapy → Osteopathy ⁹²² Medical Care & Services → Pediatric & Child Health ²¹²¹	reimbursement ⁴⁶⁵ fee ⁶⁴⁰ osteopathy ⁸⁰⁹ practice ⁹⁰⁸⁹ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
lansingh.nl	Krimpense Zwemvereniging de Lansingh	The website of Krimpense Zwemvereniging de Lansingh presents the association, its activities and the possibilities for members and interested parties.	Sports Clubs → Water Polo ²¹⁹	water polo ¹⁸⁴ association ⁸⁵⁶² membership ¹⁰⁴⁴²
optimakranen.nl	Optima Kranen	Optima Kranen is a company that supplies crane and lifting solutions in the Dutch market.	Logistics → Lifting Equipment ²¹⁶ Construction Machinery → Cranes ¹⁷¹	crane ⁶⁶² warehouse ¹⁰²⁷ market ²⁷⁷²
mymove.nl	MyMove Krimpenerwaard	The MyMove Krimpenerwaard website presents a wide range of sports and fitness services, including fitness, group fitness, dancing, personal training, physiotherapy, and a kids club, aimed at people of all ages and levels in the Krimpenerwaard region.	Group Class → Fitness Centers ¹⁰¹⁰ Personal & Household → Fitness Services ¹⁶²	personal training ¹²⁷¹ group classes ¹³⁰⁶ dance ¹⁸³⁴ fitness ²²⁵¹ physiotherapy ⁴⁶⁸⁸	South-Holland → Krimpenerwaard ¹⁸⁴⁰
segadicanto.nl	Vocaal Ensemble Sega di Canto Koor	The Vocaal Ensemble Sega di Canto Koor is a mixed choir dedicated to performing classical choral music, with a particular focus on modern choral pieces from the 20th and 21st centuries.	Choir → Mixed Choir ²³¹	conductor ¹²¹⁷ choir ³¹²³ concert ⁴⁴⁰⁹ music ¹³¹⁷⁰	South-Holland → Krimpenerwaard ¹⁸⁴⁰
olifantendamesbloot.nl	Olifantendamesbloot	The website presents a book about the ijsselstone industry in the Hollandsche IJssel region, focusing on the historical context, stone quarries, and the families involved in its production.	Local History → Dutch History ¹⁰⁶⁷ Specialized History → History of The Netherlands ⁷⁴	stone oven ¹²	Zuidplas → Moordrecht ³³²
oefentherapiekrimpen.nl	Oefentherapie Krimpen	The website offers physiotherapy and related services for adults and children with sleep problems, pelvic pain, and other physical ailments, and provides information about pregnancy and childbirth.	Physiotherapy → Pediatric Physiotherapy ³²⁷	melatonin ¹⁸ pelvic pain ³⁰ sleep problems ²¹⁹ group classes ¹³⁰⁶ pregnancy ²⁷³⁹ physiotherapy ⁴⁶⁸⁸
crealisation.nl	Crealisation	The Crealisation website describes an architecture firm that supports private and business clients with the construction, renovation, expansion, and sustainable renovation of homes and buildings. The firm offers a wide range of services from permit applications to complete new construction projects.	Architecture → Architectural Services ¹⁰⁰⁶	permits ⁶⁴³ new construction ²⁶⁷² architecture ³²²³ home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹	North-Brabant → Roosendaal ²⁶⁷⁷
vreugdenhilmilieuexpert.nl	Vreugdenhil Milieuexpert	Vreugdenhil Milieuexpert provides environmental consulting services, leveraging soil expertise for both policy and practical applications.	Consulting → Environmental Consulting ⁵⁵⁵	environmental consulting ²¹ remediation ¹⁴³ soil ⁹³⁰ policy ²¹⁴⁹	South-Holland → Westland ⁴⁰¹⁶
hetmozaiek-levwn.nl	Het Mozaïek	The website of basisschool Het Mozaïek in Krimpen aan den IJssel provides information about the school, its offerings, staff, and activities, and serves as a platform for parents and students to contact and seek information.	Primary Education → Protestant Schools ⁷⁴ Primary Education → Catholic Primary Education ³⁸⁰	identity ¹⁰²⁸ faith ¹⁰⁹³ school ⁷⁸⁵⁶ care ¹²³³⁸ education ¹³⁴⁷¹
voeljegoedcoaching.nl	Yvonne Balvert	The website of Yvonne Balvert offers coaching services, focused on increasing self-esteem, confidence, and promoting peace and strength for women who feel uncertain or restless.	Childcare → Individual Support ²⁰⁸ Personal Development → Self-Confidence ⁷⁰³	self-esteem ¹⁷⁵ peace ¹¹¹³ confidence ¹¹⁶³ conversation ¹⁸²⁸ workshop ¹⁹³²⁵ coach ²⁵⁸¹⁰
jckrimpenerwaard.nl	Judoclub Krimpenerwaard	The website of Judoclub Krimpenerwaard presents the judo club, its services and activities, aimed at offering judo training for all levels and promoting membership.	Martial Art → Judo ³⁸⁹ Combat → Sports Schools ⁸⁶	dojo ²³⁰ judo ³⁷⁵ tournament ²⁴⁷⁶ competition ⁴⁷⁵⁹ membership ¹⁰⁴⁴² training ²⁸¹³³	South-Holland → Krimpenerwaard ¹⁸⁴⁰
mdbcards-gifts.nl	MDB cards & gifts	The MDB cards & gifts website offers personalized cards and gifts, as well as handcrafted products such as printed textiles, glasses, and themed items, all with the option for personalization.	Gifts → Themed Gifts ¹⁸ Retail → Personalized Products ³¹	textile ¹⁴²¹ card ¹⁹⁷⁵ gift ⁶⁴⁴² workshop ¹⁹³²⁵	Goeree-Overflakkee → Ouddorp ⁴³⁸
gewoondick.nl	Gewoon DICK	The website of Gewoon DICK offers custom solutions for windows, doors, and sliding doors, focusing on residential renovation and improvement. The site provides project examples and the option to request a quote.	Windows → Frames ¹²¹¹ Roofing → Skylights ⁴⁷¹	sliding doors ²⁹⁸ skylight ⁹⁶⁶ door ²²¹⁰ frames ²⁵⁵⁶ quote ¹²⁸⁶³	Lansingerland → Bergschenhoek ⁵⁶⁸
dijkgraafautomaterialen.nl	Dijkgraaf Automaterialen	Dijkgraaf Automaterialen Centrum is an auto garage located in Capelle a/d IJssel and Krimpen a/d IJssel offering various car repair, maintenance, and accessory services.	Used Cars → Cars For Sale ⁷⁹	auto garage ¹⁵ apk ¹³³³ tire ¹⁹⁷⁵ accessories ¹²⁹⁷⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
autorijschooladios.nl	Autorijschool Adios	Autorijschool "Adios" offers driving lessons and various supplementary courses in the Krimpenerwaard and Rotterdam region.	Primary Education → Traffic Education ¹²⁸ Driver & Vehicle → Driver’s License ¹⁶²⁵	driving course ³⁹ driver's license ¹²⁸³ motorcycle ²¹¹⁰ driving lessons ²⁴⁵³
krimpenopenair.nl	MAAS Open Air	The website of Krimpen Open Air is an online platform of the Rotterdam-based festival organization MAAS Open Air, focused on promoting the Krimpen Open Air 2025 festival, an event featuring house music and various activities.	Festivals → Music Festivals ¹⁰²⁰	silent disco ⁷⁸ festival ³⁸⁰⁴ music ¹³¹⁷⁰ event ⁴⁵¹⁹⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
cursusmakelaarhaarlem.nl	Hoekstra en van Eck Makelaars	The website cursusmakelaarhaarlem.nl is a guide for growth and development in Haarlem, offering information about real estate agents, flooring, and mortgage advice.	Legal & Administration → Business Support ⁴⁸⁸ Property Agents & Brokers → Brokers ³⁵⁶	agent ¹²⁵³ mortgage ⁴⁵⁶⁴ floor ⁴⁷⁸¹	North-Holland → Haarlem ⁸⁶⁷⁴
johnstonchiropractie.nl	Johnston Chiropractie	Johnston Chiropractie offers chiropractic care in Capelle aan den IJssel with the goal of helping patients live actively and pain-free.	Physical Therapy → Chiropractic ⁴²⁰ Health → Medical Care & Services ²⁹⁴⁶¹	chiropractic ¹⁸⁴ mobility ¹²⁶⁴ pain ¹⁹¹⁹ sport ⁴²²⁸ health ⁶³⁶⁶ care ¹²³³⁸	Capelle aan den IJssel → Schollevaar ³⁷
panograaf.nl	Panograaf	Panograaf offers virtual tours and 360° photography services to showcase businesses online and provide a virtual experience of their location.	Online Marketing → Virtual Tours ¹¹¹ Arts → Imaging & Photography ⁷⁶⁸⁷	google street view ¹⁴ virtual tour ²²⁰	Rotterdam → Center ³⁸²
eslelektro.nl	Elektro Service Lumen	Elektro Service Lumen is an electrical installation company providing services in Rotterdam and surrounding areas, including installation, repair, and maintenance of electrical systems.	Security → Alarm Systems ³⁵⁰	trouble ³⁸ alarm ³⁷⁷ electrical ¹⁴¹⁴ light ⁵¹⁴⁸ installation ¹³⁷⁴²	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
enderepairs.nl	Van der Ende Repairs	The website of Van der Ende Repairs provides machine repair, maintenance, and periodic inspection services, primarily focused on machines and vehicles for the road, water, agriculture, and landscaping industries.	Machinery & Repair → Machinery ¹⁰⁴⁵ Driving & Lessons → Vehicles ⁵⁴¹	machine ³⁷²⁷ vehicle ³⁷⁴³ inspection ⁴²⁷⁹ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³
kwastconsult.nl	Kwast Consult	Kwast Consult is a geotechnical consulting bureau that provides advice and innovations in various civil and geotechnical projects.	Consulting → Environmental Consulting ⁵⁵⁵ Civil & Infrastructure → Geotechnical Engineering ⁵⁶	rail infrastructure ³¹ dike ¹⁴⁸ risk analysis ²¹⁷	Westerkwartier → Zuidhorn ²⁸⁶
gbisdkrimpen.nl	GBI S&D Krimpen	The website of GBI S&D Krimpen is an online platform and physical location that focuses on providing products and services to the construction and industrial sectors, specifically tools, fasteners and machines.	Mining & Materials → Industrial Materials ⁷⁶ Industry → Industrial ¹⁹⁸⁷	building materials ⁴⁸⁶ stock ¹¹⁵⁴ tool ³⁹⁰⁷ showroom ⁴⁸⁸³ vacancy ⁶⁵⁹⁸ assortment ⁷⁷⁹⁹
concordiakrimpen.nl	Muziekvereniging Concordia Krimpen aan den IJssel	Concordia Krimpen aan den IJssel is a musical society offering opportunities to participate in various musical ensembles, including a youth brass section, fanfare orchestra, and melody & percussion group.	Associations & Societies → Music Societies ²²⁸	fanfare ¹⁷¹ rehearsal ¹⁶³⁹ youth ³¹²⁶ news ¹⁵²⁹³
huisartsenpraktijkkrimpen.nl	Huisartsenpraktijk Krimpen aan den IJssel	The website of Huisartsenpraktijk Krimpen aan den IJssel provides information about the general practice, including opening hours, the care team, appointment options, and various medical information and services.	Body & Movement → Preventative Care ³⁴⁴ Medical Care & Services → Primary Care ⁵⁶⁹⁹	medical data ⁵⁷ general practice ²⁰⁴ vacancy ⁶⁵⁹⁸ care ¹²³³⁸ appointment ¹³⁵¹⁰
imagedeux.nl	Image Deux	Image Deux is an online and physical boutique offering trendy and unique brands in the areas of clothing, accessories, shoes, and lifestyle.	Economy → Retail & Commerce ⁹⁹⁴¹	shoes ²⁶⁹⁹ lifestyle ²⁹¹⁸ store ³⁹⁰¹ collection ⁷⁵⁶⁶ clothing ⁹⁴⁴³ accessories ¹²⁹⁷⁵
boetiek115.nl	Boetiek115	Boetiek115 is an online and physical fashion store selling women's clothing, focusing on offering new items and sales.	Clothing → Tops ¹⁴³ Context ¹⁶¹³⁹⁴	discounts ⁷⁹⁵ fashion ²²¹² collection ⁷⁵⁶⁶ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷
wereldwinkelkrimpen.nl	Wereldwinkel Krimpen aan den IJssel	Wereldwinkel Krimpen aan den IJssel is a retail store specializing in fair trade and sustainable goods.	Islam → Centers ⁸⁰	dopper ¹⁰ pottery ¹⁵² basket ²⁷⁵ socks ⁴⁸⁹ shop ⁶⁴⁸³ event ⁴⁵¹⁹⁹
punthoveniers.nl	Punt Hoveniers	Punt Hoveniers is a landscaping company specializing in the design, installation, and maintenance of gardens, with a focus on projects in the region of Krimpen aan den Lek, Krimpen aan den IJssel, Schoonhoven, and The Hague. The company offers a range of services, including garden design, landscaping, maintenance, fence construction, and shoreline reinforcement.	Garden Maintenance → Landscapers ²⁸⁷ Garden Design → Garden Designers ⁹⁶	lawn ⁴²⁷ landscaping ¹⁵²⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
stormcleaningservice.nl	Storm Cleaning Services	Storm Cleaning Services is a company specializing in industrial cleaning and emergency response.	Cleaning Services → Industrial Cleaning ⁸⁵	emergency ⁷⁵⁰ logistics ³²⁵⁷ cleaning ⁴⁵⁶⁷
miniopslagkrimpenerwaard.nl	Miniopslag Krimpenerwaard	The website of Miniopslag Krimpenerwaard offers temporary storage space and storage boxes for rent, targeting both private and business customers in the Krimpenerwaard region.	Logistics → Storage ¹¹⁷⁰	storage space ³⁸⁸ box ¹⁹⁸² storage ²⁴⁴⁶ space ³⁸⁴⁶ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
massagebyyulianti.nl	Massage by Yulianti	This website of Massage by Yulianti presents the services of a massage salon specializing in Indonesian massage-ibu pitjit, as well as other massage and wellness treatments.	Salon & Treatment Centers → Beauty Centers ⁶³¹	wellness ¹⁵⁶¹ salon ⁵⁵⁴¹ massage ⁷⁶⁴⁶ treatment ²¹²⁰³	North-Brabant → Oosterhout ²⁰⁸⁶
massagesalon-monikaperger.nl	Monika Perger	The website of Massagesalon Krimpen aan den IJssel presents the services of Monika Perger, a skilled massage therapist who offers sports, relaxation, and cupping massages, with a special focus on treating sports injuries and pain complaints.	Massage → Massage Clinics ³²⁹	injury ⁵⁴³ sport massage ⁶³⁰ pain ¹⁹¹⁹ relaxation ³⁹⁶⁸ massage ⁷⁶⁴⁶
tpphagen.nl	Tandprothetische Praktijk Hagen B.V.	The website of Tandprothetische Praktijk Hagen B.V. presents a dental prosthesis practice with locations in Krimpen aan den IJssel, Schoonhoven, and Rotterdam, specializing in the fitting and repair of dentures, dental implants, and partial dentures.	Dentistry → Prosthodontics ³⁷⁰	click denture ³⁵ prosthesis ³⁹³ denture ⁴⁶² implant ⁶¹³	Krimpenerwaard → Schoonhoven ⁵⁴⁴
emvoadvies.nl	Emvo Administratiekantoor	Emvo Administratie is an administrative office specializing in services for both businesses and individuals, offering tax advice, bookkeeping, and financial planning.	Administration → Secretarial Services ⁸⁵¹ Accounting → Business Accounting ⁶⁸⁸	financial ⁸⁵⁵ bookkeeping ¹³¹⁹ payroll ¹⁸²³ tax ²¹⁰⁰ administration ⁶⁵⁸⁷
dietistkrimpen.nl	Dietist Krimpen	The Dietist Krimpen website offers nutrition and health advice to individuals and businesses, with expertise in various conditions such as diabetes, obesity and digestive problems.	Nutrition → Dietetics ⁸¹⁶	cooperation ⁴³³ diet ⁷⁴⁷ diabetes ⁷⁵⁰ nutrition ⁴⁹³⁵ health ⁶³⁶⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
dejonginterieurbouw.nl	Jan de Jong Interieurbouw B.V.	Jan de Jong Interieurbouw is a company based in Bergambacht that designs and manufactures custom furniture and interiors.	Interior → Furniture ⁷⁴⁵⁴ Finishing & Trades → Interior Construction ⁵⁰²	cabinet ¹⁷³⁰ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹ design ²⁷²⁰²	Krimpenerwaard → Bergambacht ³⁰³
hondenschoolrotterdam-usv-vop.nl	Hondenschool Rotterdam USV-VOP	Hondenschool Rotterdam USV-VOP offers various dog training courses and activities, focusing on puppies, beginners, advanced dogs, and specific disciplines like agility and hoopers.	Dog Training → Dog School ⁹³ Competitive Activity → Dog Sports ²²⁵	obedience ⁶⁸ agility ¹⁷⁰ course ¹⁴⁷²⁸	Nieuwkoop → North ¹¹⁷
fonteinkerkkrimpen.nl	Fonteinkerk Krimpen	The Fonteinkerk Krimpen website provides information about the church services, activities, and contact details of the Christian community.	Protestantism → Protestant Church in The Netherlands (PKN) ³⁰¹	youtube ⁴⁸⁶ church service ⁸⁷⁹ app ⁴⁵⁹⁵ donation ⁵¹¹⁰ newsletter ⁶⁵⁰⁴ community ⁷⁹³¹
ehbokrimpen.nl	EHBO Krimpen aan den IJssel	EHBO Krimpen aan den IJssel is a community organization that provides first aid training and resuscitation courses to residents of Krimpen aan den IJssel.	First Aid → Resuscitation ²¹³	resuscitation ²⁵⁰ first aid ⁶⁰⁸ knowledge ³⁵²⁸ student ⁷⁶²³ association ⁸⁵⁶² course ¹⁴⁷²⁸
tbuijs.nl	T. Buijs Loodgieter-en Installatiebedrijf	The website of T. Buijs Loodgieter-en installatiebedrijf presents the services of a plumber and installer, focusing on heating installations, water installations, sanitary ware, drainage, and water pipes. The company offers both services and advice and is affiliated with the KVK (Chamber of Commerce).	Home Improvement → Plumbing ²⁷³³ Maintenance & Repair → Plumbers ⁸⁷⁹	heating installation ¹³ plumbing services ³⁴ water installation ³⁸ sanitary ware ⁶⁶⁹ drainage ¹³²²	Voorne aan Zee → Brielle ⁶¹³
hilto.nl	Hilto Technische Handelsonderneming B.V.	Hilto Technische Handelsonderneming is a specialist in pipes and connections offering a wide assortment and fast delivery.	Trade → Technical Trade ¹⁹⁷ Manufacturing → Metals & Fabrication ¹²²⁴	flange ²⁴ fittings ¹³⁰ pipe ⁶⁹⁵ accessories ¹²⁹⁷⁵
verstopping-gouda.nl	Rioleringsbedrijf Gouda	The website of Rioleringsbedrijf Gouda offers rioolservice (drainage services), unclogging services, and other pipe repair services in Gouda and surrounding areas.	Water Management → Sewers ²⁵ Personal & Household → Service Industry ³⁷⁶	unclogging ²⁴⁴ sewer ²⁴⁶ drainage ¹³²² region ⁵⁴¹²	Krimpenerwaard → Bergambacht ³⁰³
tuinierkrimpen.nl	Unspecified	The website offers office space, workspaces, and meeting rooms for rent, primarily in the Rotterdam, Utrecht, and The Hague regions.	Commercial Properties → Offices ⁷⁷³ Context ¹⁶¹³⁹⁴	led screen ⁶³ meeting rooms ²⁴⁰ office space ⁷⁷³ space ³⁸⁴⁶ catering ⁶⁴⁵⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
kindercoaches.nl	Kindercoaches B.V.	The website provides an overview of various childcare coaches and helps parents find the right coach for their child.	Directories → Portals ³⁶⁹ Childcare → Child Coaching ³⁴³	parenting coach ¹² sleep coach ⁹¹ child ¹¹⁵⁶⁶ coach ²⁵⁸¹⁰	Purmerend → Middenbeemster ³⁶⁷
schipholtaxikrimpenaandenijssel.nl	Schiphol Taxi Krimpen aan den IJssel	The website of Schiphol Taxi Krimpen aan den IJssel provides taxi services from and to the airport Schiphol, primarily from Krimpen aan den IJssel. The company emphasizes a long experience and a customer-oriented approach.	Taxi & Ride Services → Shuttle ¹²⁵ Taxi & Ride Services → Airport Transportation ³⁶⁵	shuttle ²⁴¹ taxi ²⁰⁹⁰ transportation ²⁸⁵¹ network ¹¹¹²³	Haarlemmermeer → Schiphol ²¹⁶³
marjanpolsdepee.nl	Marjan Pols-de Pee	The website of Marjan Pols-de Pee presents a practice offering psychosocial support and herbal therapy, employing a nature-based and holistic approach.	Alternative Medicine → Naturopathy ¹⁰⁹⁷ Special Needs & Support → Support ²⁰⁰⁶	psychosocial support ²⁰ herbal therapy ²⁵ holistic approach ⁵⁸ access bars ¹³²	South-Holland → Rotterdam ²⁵⁰⁴⁸
denimandmorebysil.nl	Denim & More by Sil	The Denim & More by Sil website is both an online and physical store located in Krimpen a/d IJssel, offering trendy women's and men's clothing.	Clothing → Men’s Clothing ¹⁰⁰⁸ Context ¹⁶¹³⁹⁴	womens clothing ²² store ³⁹⁰¹ clothing ⁹⁴⁴³ brand ¹⁷⁷³⁷	South-Holland → Rotterdam ²⁵⁰⁴⁸
bistrolr.nl	La Retraite	La Retraite is a lunch bistro located in Krimpen aan den IJssel offering French-Italian inspired food and drinks.	Commerce → Shopping Centers ¹⁰⁰¹ Fine Dining & Gastronomy → Dining ⁶⁷⁷	high wine ²¹ bistro ²¹⁹ high tea ⁵⁸⁵ cake ¹⁷³⁰ coffee ³⁸³⁸ menu ¹³⁸⁵⁶
groepenkast-expert.nl	Groepenkast-Expert	The website offers services for replacing and expanding electrical distribution boards (group boxes), including kitchen electrical adjustments and upgrades. The company aims for competitive pricing and fast service.	Installation & Fixings → Installation Materials ²⁴⁷ Electrical Engineering → Electrical Technology ¹⁹⁶	group box ⁵³ mounting ⁴⁴⁸ warranty ⁴⁷⁰¹ quote ¹²⁸⁶³	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
sluimerschoenen.nl	Sluimer Schoenen en lederwaren	Sluimer Schoenen en lederwaren is a shoe store offering a diverse collection of shoes and leather goods for men and women.	Clothing → Women ¹⁷⁶ Clothing → Men ⁷⁴⁴	leather goods ⁷² shoes ²⁶⁹⁹ collection ⁷⁵⁶⁶ brand ¹⁷⁷³⁷	South-Holland → Sliedrecht ⁸⁶³
restaurantzoutsteen.nl	Restaurant Zoutsteen	Restaurant Zoutsteen in Krimpen aan den IJssel is a stylish Fusion restaurant offering an unlimited course menu with a diverse menu, focusing on a complete culinary experience and high-quality service.	Specialty Foods → Fusion Restaurants ¹³	dessert buffet ¹⁰ dish ⁵⁹³⁶ menu ¹³⁸⁵⁶
capelleaandenijssel-loodgieter.nl	Folstra B.V.	The website of Folstra B.V. presents the company as a plumbing and installation service provider operating in Capelle Aan Den IJssel and surrounding areas.	Home Improvement → Plumbing ²⁷³³	pipework ⁸⁴ sewer ²⁴⁶ installer ⁶⁷⁷ sanitary ⁷⁵⁰ leak ¹²⁰⁴ heat ²¹⁸⁸	Lansingerland → Bergschenhoek ⁵⁶⁸
sedum-daken.nl	Sedum Daken	The Sedum Daken website provides information about sedum roofs (also known as extensive green roofs) and offers advice, information about subsidies, and explanations about the benefits of this sustainable roofing solution.	Roofs → Green Roofs ¹⁴⁵	sedum ⁷⁴ advisory ¹⁴⁶ mat ²⁴⁹ subsidy ²⁶⁴⁹ roofing ²⁸⁰⁶ roof ³⁶⁶²
christe.nl	Christe Maritiem	The website of Christe Maritiem is an online platform describing the company’s diverse maritime services, including lifting operations, dredging, and maintenance, with a long history and a focus on nautical services.	Machinery & Repair → Machinery ¹⁰⁴⁵ Marine & Shipping → Maritime ¹⁰²²	lifting operations ¹³ dredging ⁹⁸ scaffolding ⁵¹⁹ certificate ¹⁰³⁶ ship ⁵¹⁰³
smitsmakelaardij.nl	Smits Makelaardij	The website of Smits Makelaardij provides information about real estate transactions, including the sale, purchase, and valuation of homes in the region of Capelle, Krimpen, Rotterdam, Schiedam and Vlaardingen. The aim is to inform potential buyers and sellers and to contact them for services.	Property Agents & Brokers → Regional Brokers ³⁸	brokerage ⁴³³ purchase ²²¹² valuation ²⁶⁹⁷ region ⁵⁴¹² sale ⁵⁹³⁰ property ⁷⁴⁰⁶	South-Holland → Rotterdam ²⁵⁰⁴⁸
boenderwonen.nl	Boender Woonbeleving	Boender Woonbeleving is a company that creates living experiences and offers a variety of interior products and services.	Textiles → Fabrics ³⁷¹ Interior → Curtains ⁸³¹	insect screen ⁴³ sun shading ⁸³⁵ mattress ⁸⁹⁹ window coverings ¹²¹³ floor ⁴⁷⁸¹
uitvaartzorgbakker.nl	Bakker and Zoon Uitvaartzorg	The website of Bakker and Zoon Uitvaartzorg provides funeral care and services in the Rotterdam region and surrounding areas, including burials, cremations, and natural burial grounds.	Trauma & Recovery → Grief ⁹⁰⁷ Funeral Services → Funeral Arrangement ⁴⁸⁶	natural burial ground ¹⁵ coffin ¹⁸⁵ burial ⁴⁰⁶ cremation ⁶¹⁵ funeral ²⁴⁷⁷ quote ¹²⁸⁶³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
vanreeuwijkuitvaartzorg.nl	J.C. van Reeuwijk	The website of Begrafenisonderneming J.C. van Reeuwijk offers complete funeral arrangements within the Krimpenerwaard area and Krimpen aan den IJssel, providing personalized support and careful execution of the deceased’s wishes.	Family → Funeral Services ²⁰⁸⁴	funeral ²⁴⁷⁷ wishes ²⁷¹⁷	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
mossvisuals.nl	MOSS visuals	The MOSS visuals website presents a collection of architectural visualizations and locations, including public spaces, buildings, and landscapes.	Architecture → Visualization ¹⁸⁰ Design → Product Design ⁷²²	visualization ⁶²¹ building ³²⁰⁴ architecture ³²²³	Breda → Bavel ²⁶⁴
vangeetschilders.nl	Van Geet Schilders	Van Geet Schilders is a painting company that offers painting and spray painting services, serving individuals, businesses, and institutions in the region.	Windows → Glazier ⁴⁴⁰ Household & Cleaning → Spraying ³⁸⁷	spray painting ¹⁷⁵ craftsman ¹⁸⁸ paint ⁸⁷⁴⁷ quote ¹²⁸⁶³	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
inhaagseliteratuurkringen.nl	Marty van Welij	In Haagse literatuurkringen is an online platform supporting literature enthusiasts through book clubs guided by Marty van Welij.	Literature → Book Clubs ¹⁵ Education → Adult & Continuing Learning ⁶⁵¹⁰	book club ³⁹ novel ⁴⁴⁰ literature ⁴⁸⁷ book ¹¹³⁹⁶	South-Holland → The Hague ¹⁹⁸⁹⁸
autobedrijfadvandenbos.nl	Autobedrijf Ad van den Bos	The website of Autobedrijf Ad van den Bos showcases their services, including car maintenance, repairs, accident repair, used car sales, and financing assistance, with a focus on a personalized customer approach.	Loans & Credit → Auto Loans ²⁴² Automotive → Car Dealerships ¹⁶⁴⁷	used car ⁸²⁵ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³
jaapdewildbeheer.nl	Jaap de Wild beheer B.V.	Jaap de Wild beheer B.V. is a trading company specializing in the purchase and sale of real estate.	Real Estate → Property Valuation & Appraisal ²¹²³ Context ¹⁶¹³⁹⁴	trading company ¹³ commercial property ⁴⁶⁹ office space ⁷⁷³ real estate ⁴⁹⁸¹	Rotterdam → Prins Alexander ⁴³²
speciaalvanmij.nl	Speciaal van mij	The website ‘Speciaal van mij’ is an online shop selling handcrafted products made and packaged by individuals with disabilities from Adullam.	Initiatives & Projects → Social Initiatives ⁴⁵ Fashion → Fragrances ⁵⁹⁸	distribution center ⁷⁷ whatsapp ³⁸² employee ⁴⁴²⁹ gift ⁶⁴⁴² order ⁶⁹¹²
rook-zn.nl	Rook & zn B.V.	The website of Rook & zn B.V. presents the corporate profile of a metal production company that has been active since 1930 and has developed into a reliable partner for various industries.	Hospitality → Suppliers ¹⁰⁵⁷ Garden → Fences ⁸²⁴	bracket ⁵⁷ metal ¹⁰⁹⁰ production ⁴⁵⁸² assortment ⁷⁷⁹⁹
dutchlandscape.nl	Studio Kunstzyde	The website 'Dutch Landscape' presents photography of the Dutch landscape, primarily around Amsterdam Southeast, with specific attention to locations such as Het Gein, the Hoge Veluwe and along the IJssel.	Nature & Landscape → Landscape Photography ⁵³⁰	landscape ²⁶⁰⁹ photo ⁷⁷⁷⁸	Ede → Otterlo ³⁷¹
krimpen112.nl	Krimpen 112	The website provides the latest emergency news from Krimpen 112.	Emergency Services → Fire Department ¹³⁸ News & Journalism → Regional News ⁹⁴⁸	accident ³³⁰ fire ⁴²⁹ traffic ⁹¹⁶ scooter ¹²³⁶ building ³²⁰⁴ body ³⁴⁹⁰	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
barbierbal.nl	Barbier Bal	The website of Barbier Bal presents the services of a barber in Krimpen aan den IJssel and provides options for making an appointment.	Men’s Grooming → Barbers ³⁹³	barber ⁴¹⁸ haircut ¹¹⁵⁸ price ⁸³²⁸ appointment ¹³⁵¹⁰
bakeryfromthecorner.nl	Bakery from the Corner	The Bakeryfromthecorner website is an online bakery specializing in the creation and sale of cakes, cupcakes, cookies, and treats, with a focus on custom orders for special occasions.	Bakery & Food Production → Online Bakeries ⁵⁶ Parties → Birthdays ¹⁹³	cupcakes ²⁷⁴ treat ³⁷³ cookie ⁶⁰² cake ¹⁷³⁰ holiday ²²⁹⁵ recipe ⁵¹⁴²
wivon.nl	WIVON	The WIVON website provides information about the services of a certified chimney sweep in Oosterhout and the surrounding area.	Home Maintenance → Chimney Services ⁴⁰	chimney sweep ¹¹¹	Zundert → Wernhout ⁷⁷
hc-krimpenerwaard.nl	Stal de Waal	The website of Stal de Waal presents the stable, its facilities, lesson offerings, and current coronavirus-related measures.	Animals → Animal Welfare ¹³⁷²	stable ⁷⁶⁸ facility ²⁶¹⁶ horse ⁴³³⁷ lesson ⁵¹⁵⁴	South-Holland → Krimpenerwaard ¹⁸⁴⁰
huisartskrimpen.nl	Huisartsen Krimpen Midden	The website of Huisartsen Krimpen Midden provides information and contact details for the Blankers, van Dalsen, ten Hoeve, Liem & Mes-Krowinkel house call practice, located in the health center in Krimpen aan den IJssel. It also offers important contact information for emergencies and details about the IJsselland house call department.	Medical Care & Services → Primary Care ⁵⁶⁹⁹	house call practice ¹¹ contact details ¹⁰⁸ health center ¹⁹³ emergency ⁷⁵⁰
speelgoedsteentjes.nl	Speelgoedsteentjes.nl	Speelgoedsteentjes.nl is an online shop selling Lego and Duplo building blocks and offers a wide variety of themes.	Toys → LEGO ¹⁹⁵	duplo ²¹ lego ³⁴¹ theme ⁴⁰¹⁵	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
schoonheidssalonastria.nl	Astria	The website of Astria Beauty Salon in Krimpen aan den IJssel offers a range of skin rejuvenation treatments, including PMU, Guasha, Bio Skin Jetting, and permanent makeup, alongside complementary beauty services and products.	Hair Care → Salons ¹⁴⁷⁶	guasha ⁹⁶ skin rejuvenation ²⁴¹ permanent makeup ⁷⁰² treatment ²¹²⁰³
wildopvangzuidholland.nl	Stichting Dierenambulance de Wijs	The website provides information about animal rescue centers and animal ambulances in South Holland, which are in liquidation.	Animal Welfare → Animal Rescue ¹¹⁹ Animal Welfare → Animal Shelters ³²⁶	hedgehog ²⁵ animal ambulance ⁵² rodent ⁵⁸ shelter ³⁸⁵ bird ⁹²² animal ²⁹⁰⁸	Westland → Maasdijk ³⁸³
bedderijkrimpen.nl	Bedderij Krimpen BV	Bedderijkrimpen.nl is an online store selling boxsprings, mattresses, pillows, bedding, and accessories.	Bedroom → Beds ⁷⁰²	payment methods ¹⁵⁹ boxspring ²⁸² mattress ⁸⁹⁹ bed ¹³⁸⁴
jokokrimpen.nl	JOKO Youth Choir	The website of the JOKO Youth Choir from Krimpen aan den IJssel presents the choir members, their repertoire, agenda, and activities, including events and volunteer opportunities.	Choral → Choir ¹⁸⁴²	rehearsal ¹⁶³⁹ repertoire ²⁴⁹⁷ band ²⁹⁷⁷ choir ³¹²³ event ⁴⁵¹⁹⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
live112.nl	Live112	The website presents live 112 alerts from various emergency services, including fire, ambulance, and police, along with information about locations and code codes.	Emergency Services → Fire Department ¹³⁸ Emergency Services → Ambulance ³⁷	alerts ¹⁵¹ emergency service ³⁷² region ⁵⁴¹²	Boxtel → Liempde ²³²
pkenergy.nl	PK Energy	The website of PK Energy is a wholesale and supplier of oil and related products, primarily in the Rotterdam region and other Randstad areas, offering a wide range of fuels, lubricants, and AdBlue.	Commerce → Wholesale ¹⁸⁵⁵ Fuel & Energy → Fuels ²²⁴	adblue ⁴³ lubricant ²⁴⁴ wholesale ²⁸⁰ fuel ⁴²⁴ supply ⁹⁶¹ oil ⁹⁷⁰	South-Holland → The Hague ¹⁹⁸⁹⁸
degelenzotrappen.nl	Trappenfabriek Fa. M. Geleijnse & Zoon	Trappenfabriek Fa. M. Geleijnse & Zoon is a family-run business specializing in the design, manufacturing, and installation of custom wooden stairs.	Construction & Renovation → Staircases ³²⁹ Construction & Renovation → Stairs ¹¹⁰	staircase ⁴⁵⁴ wood ⁴¹⁵³ design ²⁷²⁰²	Altena → Veen ¹⁰⁶
uitlaatservicekrimpenerwaard.nl	Hondenuitlaatservice Krimpenerwaard	Hondenuitlaatservice Krimpenerwaard offers a dog walking and dog snack service in the Gouda, Krimpenerwaard, and Krimpen a/d IJssel region.	Dog Care → Dog Walking Service ³⁵⁶ Family → Pet Services ⁵⁴	field ⁵²⁷ game ²⁸⁰⁷ snack ²⁹¹⁶ dog ⁵⁴⁸³	Krimpenerwaard → Bergambacht ³⁰³
zonpiek.nl	ZonPiek zonnepanelen	The website of ZonPiek solar panels offers information and a quote request for solar panels in Rotterdam and Capelle aan den IJssel, targeting homes and SMEs.	Financial Management → SME ¹⁶¹	solar panels ⁴⁷⁰¹ energy ⁹⁰⁷⁵ quote ¹²⁸⁶³ installation ¹³⁷⁴²	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
slotenmaker-krimpen.nl	Slotenmaker Krimpen	The website offers locksmith services in Krimpen aan den IJssel, 24/7, emphasizing fast and reliable service.	Transportation → Emergency Services ⁶³⁰	open ⁹² lock ³⁶⁸ locksmith ⁹¹⁹ door ²²¹⁰ price ⁸³²⁸
laurencehoveniersbedrijf.nl	Laurence Hoveniersbedrijf	Laurence Hoveniersbedrijf provides garden design, landscaping, and maintenance services for individuals, schools, and businesses.	Garden Maintenance → Professional Garden Maintenance ¹⁶⁶	landscaping ¹⁵²⁹ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³ design ²⁷²⁰²
abrahamsarah.nl	Abrahamsarah.nl	The website provides an overview of rental companies for inflatable figures and attractions, with a focus on Abraham and Sarah pop rentals, and shows locations per province.	Event Rental → Attraction Rental ⁷⁵ Logistics & Transportation → Rental Companies ⁴¹⁴	pop ³⁴ rental company ⁵² inflatable figure ¹⁰⁹ party rental ¹²⁴ party supplies ³⁹⁴	Nissewaard → Abbenbroek ⁶⁹
vuik-logistics.nl	Vuik Logistics	The website of Vuik Logistics presents logistics services, including transport, loading and unloading, express transport, distribution, and home delivery, with a focus on customer satisfaction and family business values.	Transport Companies → General Transportation ⁶¹ Logistics & Transport → Logistics ⁷⁴⁴⁴	loading and unloading ¹¹ home delivery ²³ transport ⁶¹⁰⁵	Krimpenerwaard → Lekkerkerk ²⁴⁴
straatwerkprojecten.nl	Koelewijn Bestratingen	The website, Straatwerk Projecten, informs residents of Krimpen aan den IJssel about ongoing street work projects in the municipality, including information, photos, and job vacancies.	Civil & Infrastructure → Public Works ⁴⁶ Context ¹⁶¹³⁹⁴	streetwork ¹¹² job vacancies ¹²⁴¹ municipality ⁶⁸³⁷
kledingreparatiedekorf.nl	Kledingreparatie de Korf	Kledingreparatie de Korf is a company specializing in clothing repair, dry cleaning, upholstery, and custom tailoring.	Clothing → Alterations ⁸⁴ Crafts → Sewing ⁵⁹¹	custom tailoring ²⁴ clothing repair ⁷⁹ dry cleaning ²⁶⁰ home decor ⁴⁰⁰ upholstery ⁶⁷³ curtains ¹⁰¹⁵
yoga-krimpen.nl	Yogapraktijk de Regenboog	Yogapraktijk de Regenboog is a yoga studio in Krimpen aan den IJssel offering Feldenkrais yoga and pregnancy classes.	Body & Movement → Movement ⁹⁶⁷ Children → Baby ¹⁰⁶⁹	feldenkrais ¹⁴ baby massage ¹⁶⁶ class ²⁰⁷⁶ yoga ³⁷⁰⁴
immanuelkerkkrimpen.nl	Immanuelkerk NGK Krimpen	The website of Immanuelkerk Krimpen provides information about the church, its activities, and its faith-based message.	Reformed → Dutch Reformed Church ²¹⁹ Neighborhood Focus → Neighborhood Initiatives ¹⁰⁰¹	faith ¹⁰⁹³ church ³⁴³⁹
vanderlely.nl	van der Lely & van der Lely	The website of van der Lely & van der Lely presents a diverse range of businesses, including commercial real estate rental and escape room franchises, as well as luxury massage chair rental and business consulting services.	Games → Escape Rooms ⁴¹⁰ Food & Beverage → Franchising ²⁵⁴	massage chair ⁵⁰ franchise ²⁸⁴ escape room ⁴³⁰ investment ²⁰⁷⁰ real estate ⁴⁹⁸¹	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
kraamzorgdeijssel.nl	Kraamzorg de IJssel	Kraamzorg de IJssel provides personalized postpartum care services in the Capelle aan den IJssel region and surrounding towns.	Pregnancy & Childbirth → Postpartum Care ⁶⁵⁸	need ⁴⁶⁹ emergency ⁷⁵⁰ baby ¹⁸⁹⁵ family ⁶⁴⁶² care ¹²³³⁸	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
bloemenstudiohanneke.nl	Bloemenstudio Hanneke	The website of Bloemenstudio Hanneke is an online platform where individuals and businesses can order floral arrangements and flowers for various occasions, including special events and funerals. It offers a selection of floral designs, flower subscriptions, and indoor plants, delivered in the Alblasserdam and Krimpen aan den IJssel regions.	Florists → Online Flower Shops ²⁹³ Weddings → Floral Decoration ⁸⁷	floral arrangement ³⁴⁴ flowers ³²⁴⁸ order ⁶⁹¹²	South-Holland → Alblasserdam ⁸²⁶
installatiebedrijfgardenier.nl	Installatiebedrijf Gardenier	Installatiebedrijf Gardenier is an installation company based in Krimpen aan den IJssel that offers a variety of installation services.	Personal & Household → Service Industry ³⁷⁶ Installation & Mounting → Installers ¹⁰⁰⁷	zinc ³⁶⁷ sanitary ⁷⁵⁰ boiler ¹²⁴⁰ plumbing ¹⁷⁶¹ heat ²¹⁸⁸ roof ³⁶⁶²	South-Holland → Krimpenerwaard ¹⁸⁴⁰
yyo.nl	YYO Letselschade advocaat Cappelle aan den IJssel	The website of YYO Letselschade advocaat Cappelle aan den IJssel offers legal assistance to individuals who have suffered damage due to an accident or incident, such as traffic accidents, workplace accidents, or medical errors, and where compensation is due.	Criminal Law → Personal Injury ⁷⁷¹	accident ³³⁰ personal injury ⁴²⁸ compensation ⁵⁷⁶ case ¹¹⁵³ lawyer ²⁶⁸³	South-Holland → Rotterdam ²⁵⁰⁴⁸
meubelmakerijvandam.nl	Meubelmakerij van Dam	The website of Meubelmakerij van Dam presents an interior construction company that focuses on the production of custom furniture and interiors for both individuals and businesses.	Kitchen → Custom Furniture ⁴⁷³ Finishing & Trades → Interior Construction ⁵⁰²	wood ⁴¹⁵³ interior ⁸⁰⁹³ furniture ⁸⁷⁵¹	South-Holland → Rotterdam ²⁵⁰⁴⁸
witgoedservice.nl	Witgoedservice	The website offers professional appliance repair services through a network of technicians in the Netherlands.	Household Appliances → Appliance Repair ²²⁴ Repair → Mobile Phone Repair ¹⁰¹²	dryer ²⁰³ dishwasher ³²⁴ washing machine ⁴⁸⁷ technician ⁸¹⁵ appliance ⁹⁵⁶ repair ¹⁴⁵⁷⁶	Hoeksche Waard → Strijen ²³⁶
stormpoldervastgoed.nl	Stormpolder Vastgoed	Stormpolder Vastgoed presents a portfolio of high-quality commercial units for rent in Krimpen aan den IJssel.	Commercial Property → Office Buildings ¹⁴⁴ Context ¹⁶¹³⁹⁴	commercial unit ²⁴ height ⁷⁰ land ⁴⁷² parking ¹⁹²⁸	South-Holland → Schiedam ²²⁴⁹
fysiotherapiemsc.nl	Fysiotherapie MSC	The Fysiotherapie MSC website offers physiotherapy treatments for various painful conditions and rehabilitation, with a focus on the Krimpenerwaard region.	Pain → Chronic Pain ²⁴⁰	rehabilitation ¹⁵¹² pain ¹⁹¹⁹ physiotherapy ⁴⁶⁸⁸ appointment ¹³⁵¹⁰	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
ergotherapiekrimpen.nl	Ergotherapie Krimpen	The website of Ergotherapie Krimpen provides information about occupational therapy, the practice, reimbursement, and referrals.	Rehabilitation → Occupational Therapy ³⁸⁰	occupational therapy ²¹¹ practice ⁹⁰⁸⁹ collaboration ¹⁶⁰³⁶ treatment ²¹²⁰³
hafkampmakelaardij.nl	Hafkamp Makelaardij and Valuations	Hafkamp Makelaardij and Valuations is a real estate agency and valuation firm located in Barendrecht, specializing in property valuations and purchase assistance.	Property Valuation & Appraisal → Residential Appraisal ⁶²² Real Estate → Intangible Services ⁵⁵	purchase assistance ²² property valuation ²⁵ property ⁷⁴⁰⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
ksra.nl	KSRA Administraties	The website of KSRA Administraties offers administrative and financial services to small and medium-sized businesses (SMBs) and individuals in Krimpen a/d IJssel.	Accounting → General Accounting ⁹³⁹ Accounting → Bookkeeping ¹²³⁰	tax affairs ⁵⁴ financial statement ³²¹ bookkeeping ¹³¹⁹ consulting ³⁶³⁹ administration ⁶⁵⁸⁷
prinsgardens.nl	Prins Gardens	Prins Gardens is a gardening company specializing in garden design, landscaping, and maintenance, operating in Krimpen aan den IJssel and Capelle aan den IJssel.	Garden Maintenance → Gardeners ⁶⁸⁵	garden maintenance ⁴⁶² garden design ⁹⁶⁴ landscaping ¹⁵²⁹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
terravita-tuinen.nl	Terra Vita	The website Terravita-tuinen.nl is a website of a landscaper offering gardening services for garden design, maintenance, and renovation in the region of Krimpen aan den IJssel.	Garden → Garden Houses ³⁵⁵ Garden → Garden Sheds ⁴⁰⁰	deck ²⁶⁸ tiny house ²⁹² garden maintenance ⁴⁶² garden design ⁹⁶⁴ renovation ¹³⁸⁴⁹
maatkappers.nl	Maat Kappers	Maat Kappers is a hair salon with multiple locations offering personalized hair styling to its customers.	Dermatology → Scalp Care ⁴⁰²	hair ³⁰¹⁴ app ⁴⁵⁹⁵ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	Rotterdam → Prins Alexander ⁴³²
mgdautos.nl	MGD Auto's	The website of MGD Auto's in Krimpen aan den IJssel offers a range of new and used cars and leasing options.	Loans & Credit → Auto Loans ²⁴² Leasing → Auto Leasing ⁵⁶⁵	import ⁵¹⁰ loan ⁸³² lease ¹⁵⁹⁵ finance ⁵³⁴¹ car ¹⁰⁸⁶⁵
gdebruinallroundklusbedrijf.nl	G.de bruin allround klusbedrijf	G.de bruin allround klusbedrijf is a handyman service offering various tasks, including carpentry, renovations, and installations.	Outdoor Living → Pergolas ²⁵³ Outdoor Living → Verandas ⁴⁹⁷	pergola ⁴⁹² carpentry ²²¹⁸ roofing ²⁸⁰⁶ installation ¹³⁷⁴² renovation ¹³⁸⁴⁹	Rotterdam → Prins Alexander ⁴³²
mindfix-ggz.nl	Mindfix GGZ	The Mindfix GGZ website provides professional mental healthcare, including treatments for anxiety, depression, and trauma, and offers information about the practice and its team.	Mental & Emotional Well-Being → Youth Therapy ⁵³²	addiction care ¹⁰ crisis ³⁵⁸ diagnosis ¹⁴⁹⁰ treatment ²¹²⁰³	South-Holland → Rotterdam ²⁵⁰⁴⁸
vandiemensloopwerken.nl	Van Diemen Sloopwerken	Van Diemen Sloopwerken is a circular demolition contractor based in the Leiden region offering sustainable solutions and reusing materials.	Civil & Infrastructure → Road Construction ⁴⁸¹ Building & Materials → Demolition ⁶⁸⁷	circular ³⁶⁹ crane ⁶⁶² demolition ¹¹⁴⁴ container ¹⁷⁰⁹ sustainability ¹⁸⁴⁵¹	Valkenburg aan de Geul → Valkenburg ⁹²²
kaos-architekten.nl	KAOS Architekten	KAOS Architekten is an architecture firm that focuses on the design of residential and commercial buildings, with a core emphasis on social projects and an integrated approach prioritizing human-centric design and aesthetics.	Real Estate → Housing ¹¹¹²⁰ Building → Improvement ¹⁷⁸	facility ²⁶¹⁶ housing ⁴³⁷⁸ renovation ¹³⁸⁴⁹ design ²⁷²⁰²	Southwest-Friesland → Stavoren ¹⁵⁵
zoutsteenthuis.nl	Restaurant Zoutsteen	Restaurant Zoutsteen is a sushi restaurant located in Krimpen aan den IJssel that offers traditionally prepared sushi and other Japanese dishes with fresh ingredients.	Asian → Japanese ¹⁴⁸⁸ Context ¹⁶¹³⁹⁴	uramaki ²⁶ maki ¹⁶⁹ sashimi ¹⁹⁴ poke bowl ³⁰⁸ sushi ¹⁶⁹⁵ dish ⁵⁹³⁶
francaisfacile.nl	FrancaisFacile	FrancaisFacile offers various French lessons, ranging from beginner courses to business French and summer programs.	Language Courses → French ⁸²	french ¹¹¹ holiday ²²⁹⁵ lesson ⁵¹⁵⁴ course ¹⁴⁷²⁸
adindadiana.nl	Adinda	The website offers energetic therapies and readings, specifically geared towards new mothers seeking to explore and reconnect with their intuitive and conscious motherhood.	Alternative Medicine → Energy Medicine ⁹⁸⁸ Mind & Body → Energy ³⁵⁹	energetic healing ³⁰ circle ²³⁵ soul ³⁵⁵ mother ⁶⁰³ reading ⁷⁸⁴	South-Holland → Rotterdam ²⁵⁰⁴⁸
kleinstramaasbracht.nl	Kleinstra en Zonen V.O.F.	The website of Kleinstra en Zonen is a rental and sales company for vessels and materials, with a focus on push boats, motor ships, and associated equipment.	Transportation → Water Transport ⁶⁶ Retail & Commerce → Commerce ⁸²⁴⁴	dimension ²¹⁶ certification ³³⁸⁰	Maasgouw → Maasbracht ²⁴⁸
goedkopeuitvaart-krimpenaandenijssel.nl	Goede Uitvaart Krimpen aan den IJssel	Goede Uitvaart Krimpen aan den IJssel is a website providing funeral services in Krimpen aan den IJssel, focusing on affordability and personalized care.	Legal → Death Law ⁵¹ Family → Funeral Services ²⁰⁸⁴	burial ⁴⁰⁶ cremation ⁶¹⁵ farewell ¹¹⁰⁹ cost ¹⁹⁹⁰ funeral ²⁴⁷⁷ wishes ²⁷¹⁷
hetkwispelaartje.nl	Het Kwispelaartje	Het Kwispelaartje is a dog school offering courses for dogs and their owners in the IJssel- and Lekstreek region.	Dogs → Dog Training ⁸⁸¹	theory ⁹⁵⁶ dog ⁵⁴⁸³ course ¹⁴⁷²⁸	Krimpenerwaard → Schoonhoven ⁵⁴⁴
sayasuka.nl	Energetic Practice Saya Suka	The website of Energetic Practice Saya Suka presents the services of Tineke Meijer, a practitioner who offers hypnotherapy, SoulKey, Reiki, Energetic Pressure Points, and magnetization, as well as workshops and courses. The aim is to create peace, balance, and personal growth for visitors.	Alternative Medicine → Energy Medicine ⁹⁸⁸ Adult & Continuing Learning → Spiritual Education ²³¹	hypnotherapy ⁷⁸⁰ reiki ¹²⁸⁴ blog ¹³³⁹² course ¹⁴⁷²⁸ workshop ¹⁹³²⁵ treatment ²¹²⁰³
loodgieternieuwerkerk.nl	Loodgieternieuwerkerk.nl	The website is a portal offering plumbing services in Nieuwerkerk aan den IJssel and surrounding areas.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	plumbing work ⁶⁹ blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roofing ²⁸⁰⁶	Zuidplas → Moordrecht ³³²
loodgieterouderkerk-aan-den-ijssel.nl	Loodgieter Ouderkerk aan den IJsel	The website is a portal for finding a reliable and skilled plumber in Ouderkerk aan den IJsel and surrounding areas, with a focus on quick service, free quotes, and high quality standards.	Home Improvement → Plumbing ²⁷³³ Maintenance & Repair → Plumbers ⁸⁷⁹	plumbing work ⁶⁹ blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
loodgietercapelleaandenijssel.nl	Loodgieter Capelle aan den IJssel	The website provides plumbing services in Capelle aan den IJssel and surrounding areas, focusing on speed, reliability, and transparent pricing.	Repair → Plumbing Repair ⁴⁷ Installation & Repair → Water Installation ⁸¹	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ roof ³⁶⁶²	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
loodgieterkrimpenaandenijssel.nl	Loodgieterkrimpenaandenijssel.nl	This website provides emergency plumbing services, unclogging services, and leak repair services in Krimpen aan den IJssel.	Plumbing → Drain Cleaning ⁷⁴⁵ Maintenance & Repair → Plumbers ⁸⁷⁹	clogs ⁹⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ rate ²⁶⁰⁶ roof ³⁶⁶²	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
loodgieterlekkerkerk.nl	Loodgieter Lekkerkerk	The website Loodgieterlekkerkerk.nl provides emergency service and free quotes for plumbing work, drain cleaning, leak repairs, and roof maintenance in and around Lekkerkerk, aiming to offer a reliable and skilled solution for all plumbing problems.	Home Improvement → Plumbing ²⁷³³	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
loodgieterridderkerk.nl	Loodgieter Ridderkerk	The website Loodgieter Ridderkerk provides emergency service for plumbing, drain cleaning, and roofing maintenance in the municipality of Ridderkerk and surrounding areas. The aim is to facilitate the finding and engagement of experienced and certified plumbers.	Maintenance & Repair → Plumbers ⁸⁷⁹ Personal & Household → Household Services ¹⁰⁵⁰	blockage ⁹⁶⁵ leak ¹²⁰⁴ plumber ¹²¹⁰ roof ³⁶⁶² quote ¹²⁸⁶³	Molenlanden → Nieuw-Lekkerland ¹⁸⁸
staalconstructiekrimpen.nl	Sier Hekwerk Krimpen	Sier Hekwerk Krimpen is a specialist in the supply and manufacture of ornamental fences and gates.	Garden Furniture → Gates ³⁵³ Garden → Fences ⁸²⁴	wrought iron ²¹ gate ⁴⁹⁹ points ⁶¹² steel ¹¹⁷⁷ fence ¹⁸¹⁴ color ⁴¹⁵⁹
uwhekwerkopmaat.nl	uwhekwerkopmaat.nl	Sier Hekwerk Krimpen is a company specializing in the design and manufacture of custom-made fence and garden decoration, particularly wrought iron, in both classic and modern styles.	Garden Furniture → Gates ³⁵³ Garden → Fences ⁸²⁴	wrought iron ²¹ garden decoration ²⁷ gate ⁴⁹⁹ fence ¹⁸¹⁴ restoration ³⁴¹⁷	South-Holland → Alblasserwaard ²⁸¹
budgetuitvaartkrimpenaandenijssel.nl	Mavendo	The Budget Uitvaart Krimpen aan den IJssel website offers assistance in arranging funerals, considering various budgets.	Family → Funeral Services ²⁰⁸⁴	funeral coordinator ²⁰ funeral wishes ⁵⁶ budget ¹³³⁵ funeral ²⁴⁷⁷
kraak-tack.nl	Kraak & Tack	Kraak & Tack is a consulting engineering and architecture firm specializing in solar analysis and the execution of building projects.	Manufacturing & Industrial → Engineering ³⁹¹⁹	extension ¹⁹⁴¹ architecture ³²²³ renovation ¹³⁸⁴⁹	Pijnacker-Nootdorp → Delfgauw ²³⁹
afvalcontainers-randstad.nl	Steehouwer Hoveniers	The website Afvalcontainers-Randstad.nl provides specialized waste removal services for soil, green waste, clean rubble, and other waste streams in the Randstad region, with a focus on environmentally friendly processing and customized solutions.	Logistics → Transportation ¹¹⁰² Environment → Waste Management ²⁶⁸⁰	green waste ²² removal ²⁶⁷ soil ⁹³⁰ waste ¹³¹² container ¹⁷⁰⁹	Lansingerland → Bergschenhoek ⁵⁶⁸
bureaucortland.nl	Bureau Cortland B.V.	Bureau Cortland is an accounting and tax advisory firm focused on providing administrative and fiscal services to medium and small businesses.	Administration → Secretarial Services ⁸⁵¹ Human Resources → Payroll ⁵¹⁵	business plan ³⁸⁷ annual report ⁸⁷⁷ payroll administration ⁹⁷⁹ budget ¹³³⁵ tax advice ¹⁵²² account ⁵⁷⁸¹	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
cactusmp.nl	Cactus Media Producties	Cactus Media Producties is a media production company that provides custom video, design, and animation services for events, B2B, and other media productions.	Architecture & Design → Creative Industries ¹¹⁵⁷ Event Styling & Decoration → Event Production ¹⁸⁰	company video ¹⁸ aftermovie ¹⁴⁵ animation ¹⁷⁷⁷ video ⁶⁷¹⁴ design ²⁷²⁰² event ⁴⁵¹⁹⁹	Westland → Naaldwijk ⁹⁰³
daansontbijtservice.nl	Daans Catering	Daans Catering is an breakfast service that delivers fresh breakfasts, lunch buffets and snacks to private individuals and businesses in various regions, including Gouda, Alphen aan den Rijn and Nieuwerkerk aan den IJssel.	Accommodation → Breakfast ³⁶⁴ Catering → Buffets ²⁷⁷	buffet ¹⁷⁴⁷ breakfast ¹⁸²² snack ²⁹¹⁶ catering ⁶⁴⁵⁶	Krimpenerwaard → Bergambacht ³⁰³
eetcafesantas.nl	Eetcafé Santas	Eetcafé Santas is a cafe located in Krimpen a/d IJssel that has been operating since 1994 and offers a wide menu and a cozy atmosphere.	Cafes → Brown Cafés ⁵⁹⁹ Restaurants & Dining → Fine Dining & Gastronomy ²³³⁸	carpaccio ⁴⁷ spareribs ²¹³ sauce ¹¹⁴¹ terrace ⁴⁸⁴⁷ dish ⁵⁹³⁶
emilybreedveld.nl	Emily	The website of Emily is a photographic portfolio focused on capturing spontaneous, emotional, and genuine moments from families' lives, particularly around pregnancy, the newborn phase, and daily family activities. The aim is to capture ‘core memories’ - important memories - in a personal and artistic way.	Family & Newborn → Maternity Photography ²¹⁶	moment ¹⁰³⁴ memory ¹⁶⁴¹ baby ¹⁸⁹⁵ pregnancy ²⁷³⁹ family ⁶⁴⁶² photography ⁹⁵⁰³	South-Holland → Rotterdam ²⁵⁰⁴⁸
hondenschoolonsschooltje.nl	Hondenschool "Ons Schooltje"	Hondenschool "Ons Schooltje" offers puppy and young dog training courses, emphasizing a positive and personalized approach to dog rearing.	Dog Training → Dog School ⁹³ Animal Encounters → Animal Activities ¹³	pup ⁶⁵ puppy ¹³⁶⁷ course ¹⁴⁷²⁸ training ²⁸¹³³
jasperbrinkmansportmassage.nl	Sporttherapie & Massage Jasper Brinkman	The website of Sporttherapie & Massage Jasper Brinkman offers a range of sports massage and myofascial triggerpoint therapy, focused on promoting muscle recovery and preventing injuries for athletes and non-athletes.	Massage → Sports Massage ⁶⁴¹	sport therapy ⁴⁵ sport massage ⁶³⁰ treatment ²¹²⁰³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
landelijkestijlenwonen.nl	Landelijke Stijl en Wonen	Landelijke Stijl en Wonen is a home store offering furniture and accessories in a rustic and brocante style.	Home → Decor & Furnishings ⁵⁸¹⁹ Home → Antiques & Collectibles ¹⁵²³	chalk paint ³¹ online store ⁹⁰⁵ furniture ⁸⁷⁵¹ accessories ¹²⁹⁷⁵ brand ¹⁷⁷³⁷
netco-bouwers.nl	Netco Bouwers B.V.	Netco bouwers B.V. is a construction subcontractor with over 35 years of experience, specializing in high-voltage sector projects.	Construction Companies → Construction Contractors ⁵³⁶ Metal & Materials → Metalworking ²⁹⁶⁸	construction work ¹²⁸ certificate ¹⁰³⁶	Berkelland → Eibergen ⁴¹¹
schepbv.nl	Gebr. Schep BV	Gebr. Schep BV is a construction company specializing in ground, road, and water construction projects.	Civil & Infrastructure → Water Construction ¹²⁰ Civil & Infrastructure → Water Works ¹⁶⁸	industrial site ¹⁰ dike ¹⁴⁸ locks ⁹⁵³	Wijk bij Duurstede → Cothen ¹⁶⁵
vlietvastgoedonderhoud.nl	VLIET vastgoedonderhoud BV	VLIET vastgoedonderhoud is a company specializing in property maintenance, renovation projects, installing floor systems, and constructing complete timber house (HSB) projects.	Wood & Timber → Timberwork ¹⁵⁹⁶ Renovation & Restoration → Interior Renovation ⁸⁷⁹	renovation project ¹⁰ floor system ¹⁶ property maintenance ⁷⁹ insulation ²⁴⁴⁸
aannemingsbedrijfgraveland.nl	Aannemingsbedrijf Graveland vof	The website of Aannemingsbedrijf Graveland showcases their services in the areas of extensions, renovations, skylight installations, and storage.	Wood & Timber → Timber ³³⁵	skylight ⁹⁶⁶ extension ¹⁹⁴¹ storage ²⁴⁴⁶ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹	Lansingerland → Bleiswijk ⁵⁷⁹
acupunctuurvingerling.nl	Acupuncture Ria Vingerling	The website of Acupuncture Vingerling in Krimpen aan den IJssel offers acupuncture treatments for a variety of ailments, aiming to restore the flow of bodily energy and stimulate the patient’s self-healing abilities.	Practices → Therapists ⁶²⁹	life energy ⁶⁰ health insurer ¹⁸⁷ acupuncture ¹⁵³⁷ complaint ⁶⁴⁷⁹ treatment ²¹²⁰³	Krimpenerwaard → Stolwijk ²³²
asn-gevelrenovatie.nl	A.S.N. Gevelrenovatie & Dakbedekking	The website of A.S.N. Gevelrenovatie & Dakbedekking presents the services of the company, namely facade renovation, roofing, graffiti removal and cleaning services, and provides information about the working method and references.	Maintenance & Services → Facade Maintenance ⁶⁷³ Renovation → Facade Renovation ²⁷⁹	facade renovation ¹³⁰ cleaning service ³²³ roofing ²⁸⁰⁶
bandsmaakstof.nl	Smaakstof	This website provides information about the Dutch band Smaakstof, including their repertoire, upcoming performances, and past appearances.	Performance → Live Bands ¹¹⁰ Community & Social → Pub Quizzes ¹⁹⁵	repertoire ²⁴⁹⁷ band ²⁹⁷⁷ performance ⁷⁵⁸⁶ music ¹³¹⁷⁰	Terneuzen → Sas van Gent ¹²⁵
buitensexdates.nl	buitensexdates.nl	The website is a platform where users in a specific region can meet and seek out extramarital activities.	Dating → BDSM ³⁵	advertisement ¹⁷⁰⁷ profile ¹⁹⁶⁵ partner ⁴²⁷² region ⁵⁴¹²	Hof van Twente → Diepenheim ²⁰⁰
cakesbylien.nl	Cakes By Lien	Cakes By Lien is a bakery and online shop specializing in handmade cakes, cupcakes, macarons, and bonbons, as well as offering workshops.	Pastry → Cakes ⁸²⁶ Food → Gifts & Souvenirs ²⁴²¹	macarons ⁹¹ baked goods ¹⁴⁸ cupcakes ²⁷⁴ cake ¹⁷³⁰ workshop ¹⁹³²⁵
daalder-advies.nl	Daalder-Advies	The website of Daalder provides independent real estate and mortgage advice to individuals in Roosendaal and surrounding areas, offering services related to purchase, sale, rental, and mortgage advice.	Property Sales → Buying a House ⁸⁷² Property Finance → Purchase ⁴⁹³	supply ⁹⁶¹ mortgage ⁴⁵⁶⁴ real estate ⁴⁹⁸¹ rental ⁷²⁵⁷ home ⁷⁹⁷⁶	North-Brabant → Roosendaal ²⁶⁷⁷
dankavond.nl	MAF	The website provides information about the Thank Evening of June 2, 2023, in Dordrecht, a musical and spiritual gathering with singing, music, and a collection to support a family being sent to Suriname.	Church & Religious → Organ Music ²¹² Music & Performance → Music Events ⁷⁵⁸	organ ⁶³³ anniversary ⁶⁷⁰ musician ¹²⁰⁷ choir ³¹²³ collection ⁷⁵⁶⁶	Krimpenerwaard → Berkenwoude ⁶²
degraaffuitvaartverzorging.nl	De Graaff Uitvaartverzorging	De Graaff Uitvaartverzorging provides dignified and personal funeral care in the Krimpenerwaard and Rotterdam regions.	Services → Personal Services ¹⁰⁶² Family → Funeral Services ²⁰⁸⁴	funeral care ¹³⁵ farewell ¹¹⁰⁹ funeral ²⁴⁷⁷ wishes ²⁷¹⁷ insurance ⁶³⁵⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
dutchteamsecurity.nl	Dutch Team Security	The website of Dutch Team Security offers security services including surveillance, object security, and event security.	Security & Surveillance → Security ³²⁵¹ Industry → Industrial ¹⁹⁸⁷	surveillance ¹⁹² risk ²⁸⁹⁶ security ⁶⁶⁵⁵ event ⁴⁵¹⁹⁹	Krimpenerwaard → Bergambacht ³⁰³
eenhandjenodig.nl	DigiWaard	Handje Nodig provides computer assistance, maintenance, and security services to individuals and businesses in the Krimpenerwaard and Gouda region.	Computer Hardware & Peripherals → Computer Stores ²⁸¹	internet ¹⁶⁷⁸ computer ¹⁹⁶⁹ data ⁵⁸⁷² security ⁶⁶⁵⁵ software ⁸²⁹¹	Krimpenerwaard → Bergambacht ³⁰³
fiscalistkaart.nl	Fiscalistkaart BV	The website Fiscalistkaart provides an overview of Dutch fiscalists and facilitates finding a suitable fiscalist.	Websites → Professional Websites ¹⁷ Software → Online Services & Platforms ⁷³⁵	fiscalist ¹⁰ compare ⁵⁸² search ¹⁰²⁷ quote ¹²⁸⁶³	Goeree-Overflakkee → Middelharnis ³⁴⁰
footreflexplus.nl	FootreflexPlus	This website describes the services of a foot reflexology practice located in Krimpen aan den IJssel, focusing on natural treatment methods for various ailments and conditions.	Pregnancy & Childbirth → Postpartum Care ⁶⁵⁸	reflex zone ⁴⁴ labor ¹¹⁴ fertility ²⁸⁹ foot reflexology ⁵⁹⁷ pain ¹⁹¹⁹ stress ³⁹⁶⁵
fundamentalconcepts.nl	Fundamental Concepts	Fundamental Concepts is a company specializing in the redevelopment and preservation of historical buildings and locations, with a focus on heritage and new functions.	Social & Supported Housing → Social Housing ³⁶¹ Historical Sites → Monuments ¹⁰²⁷	redevelopment ⁹³ heritage ⁸¹⁸ monument ¹¹⁶⁸ interior ⁸⁰⁹³	Zaltbommel → Poederoijen ⁵⁶
gezondheidsklachten.nl	Gezondheidsklachten	The website provides information on preventing and addressing health complaints, particularly in the workplace, focusing on the relationship between the indoor environment (air quality, water quality, building quality) and these complaints.	Occupational Medicine → Ergonomics ³²⁹	indoor environment ¹³ health complaints ²² ventilation ¹¹¹⁰	Delft → Wippolder ¹³²
gouda-glaszetter.nl	Glaspunt B.V.	Glaspunt B.V. is a glass fitter company based in Gouda that provides 24-hour glass repair and glass installation services.	Insulation → Glazing ¹⁸⁸ Exterior Works → Glass Fitting ¹¹²	glass fitter ³² glass damage ¹³⁵ window ²⁰³⁰ glass ²⁹¹⁹ quote ¹²⁸⁶³	Krimpenerwaard → Bergambacht ³⁰³
goudabierstad.nl	Gouda Bierstad	Gouda Bierstad is a specialty beer festival held in Gouda.	Festivals → Beer Festivals ¹⁷⁵ Food & Drink → Beer Culture ³⁹	brewery ⁴⁹⁸ beer ²⁸⁸⁷ festival ³⁸⁰⁴ atmosphere ⁵⁵⁹¹ event ⁴⁵¹⁹⁹	South-Holland → Gouda ³⁵²¹
hoveniersbedrijfdeegenaars.nl	Hoveniersbedrijf Deegenaars	Hoveniersbedrijf Deegenaars in Nieuwerkerk aan den IJssel offers complete services for garden design and maintenance, focusing on customized advice and unique garden designs.	Garden Maintenance → Landscapers ²⁸⁷	woodwork ³⁸⁷ garden maintenance ⁴⁶² garden design ⁹⁶⁴	Zuidplas → Moordrecht ³³²
hvbnederland.nl	HVB Nederland VOF	HVB Nederland VOF is a specialist in concrete anchoring and related services based in Krimpen Aan Den IJssel.	Building & Materials → Concrete ³⁹⁰	diamond drilling ²⁶ anchor ¹¹⁹ certification ³³⁸⁰	Netherlands → Utrecht ⁴⁸⁹⁰¹
hypnotherapiekrimpen.nl	Hypnotherapie Krimpen	The website of Hypnotherapy Krimpen offers hypnotherapy sessions to treat trauma-related complaints, including anxiety, depression, chronic pain, and stress. The goal is to help clients increase their self-confidence, promote relaxation, and achieve personal goals.	ACT & EMDR → Hypnosis ⁵⁶⁶ Practices → Therapists ⁶²⁹	hypnosis ²³⁷ weight loss ⁶⁷⁸ trauma ²¹⁰⁷ stress ³⁹⁶⁵ relaxation ³⁹⁶⁸ complaint ⁶⁴⁷⁹
imhair.nl	I’m Hair	I’m Hair is a small, family-friendly hair salon located in Krimpen aan den IJssel, offering haircuts for all ages and specializing in bridal and festive hairstyles.	Services → Hairdressers ¹⁰²¹	hairstyle ⁸¹² facebook ⁸⁵⁰ trend ¹⁸⁶⁵ salon ⁵⁵⁴¹ family ⁶⁴⁶²
jeugdkampkrimpen.nl	Jeugdkamp Krimpen	The website of Jeugdkamp Krimpen provides information about the youth camp taking place in Krimpen aan den IJssel in August 2025, including registration, activities, and opportunities to support the camp.	Social Organization → Youth Organizations ¹⁷²⁶ Youth Development → Youth ¹⁰³³	youth camp ²⁶ old paper ²⁹ flashlight ⁵⁶ camp ²⁴⁶⁶	Peel and Maas → Helden ¹⁶⁶
kaashandelmarkus.nl	Markus Kaashandel	The website of Markus Kaashandel is an information page about cheese sales at various markets in the Krimpenerwaard region, providing information about locations, opening hours, and product offerings.	Local Events → Markets ¹⁰⁹⁷ Online Retail → Food Retail ³⁴⁰	ripen ²⁶ dairy products ⁴¹ cheese ¹²⁰⁵ market ²⁷⁷²	Krimpenerwaard → Schoonhoven ⁵⁴⁴
kapsalondenise.nl	Kapsalon Denise	The website of Kapsalon Denise in Krimpen aan den IJssel showcases the salon's services, focusing on hair cutting, hair transformations with Hairtalk extensions, and providing personalized hairstyling.	Hair Care → Salons ¹⁴⁷⁶	cut ⁹²⁶ hair ³⁰¹⁴ color ⁴¹⁵⁹ appointment ¹³⁵¹⁰
khandor.nl	Fine Art Rudgieri Khandor	This website from Fine Art Rudgieri Khandor presents information about the breeding of show dogs, specifically the Xanthos Gryffindor breed, including their pedigree, show results, and health certifications.	Breed → Boxer ¹⁵	show results ²⁶ pedigree ²³² breed ¹⁷⁴⁴ dog ⁵⁴⁸³ health ⁶³⁶⁶
klimaand.nl	Klimaand	The website Klimaand presents an overview of various events and activities taking place in the municipality of Hilvarenbeek, focused on themes such as climate, nature, and culture.	Training → Lectures ¹⁷¹ Ecology & Environment → Climate ¹⁶³	film evening ¹⁵ lecture ¹⁶²⁴ exhibition ⁵³³² event ⁴⁵¹⁹⁹	Hilvarenbeek → Biest-Houtakker ³⁹
konijnenkolder.nl	Konijnenkolder	Konijnenkolder is a pension and grooming salon dedicated to the care of rabbits and guinea pigs.	Animals → Animal Care ¹⁸⁴⁹ Family → Pet Services ⁵⁴	guinea pig ⁶² grooming salon ²⁶³ rabbit ²⁹¹ pension ¹⁶⁸² food ³⁸⁷² accommodation ⁴⁹²¹	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
loco-motief.nl	Loco-Motief Amsterdam	Loco-Motief Amsterdam is an architecture firm specializing in sustainable building projects, renovations, new construction, and interior design.	Urban Planning → Urban Development ³⁷⁸	building ³²⁰⁴ architecture ³²²³ home ⁷⁹⁷⁶ renovation ¹³⁸⁴⁹ sustainability ¹⁸⁴⁵¹	Amsterdam → Zunderdorp ⁷³¹
m-buijsschilderwerken.nl	M-Buijs Schilderwerken	M-Buijs Schilderwerken is a painting company specializing in interior and exterior painting, wallpapering, and latex spraying, with a focus on enhancing the appearance of homes.	Painting → Professional Painting ¹⁵³	latex ¹⁹⁵ wallpaper ¹⁷⁵⁶ paint ⁸⁷⁴⁷
machinefabriekwencos.nl	Wencos Machinefabriek B.V.	Wencos Machinefabriek B.V. is a machine factory specializing in custom manufacturing and repair services.	Manufacturing → Machine Shops & Welding ²¹⁶	custom work ¹⁸⁷ machining ²⁷² repair ¹⁴⁵⁷⁶
mkhovenier-bestrating.nl	MK Hoveniers and Bestratingen	MK Hoveniers and Bestratingen is a landscaping company based in Capelle aan den IJssel offering services for garden design, paving and maintenance.	Garden Maintenance → Gardeners ⁶⁸⁵	gardening ⁵⁰⁵ paving ¹⁹⁴² garden ¹³¹²⁹ maintenance ²⁰⁰⁹³	Ouder-Amstel → Ouderkerk aan de Amstel ⁴¹⁰
monicasvoetenservice.nl	Monica Pedicure	The website of Monica Pedicure is an online platform for specialized foot care in Krimpen aan de Lek and surrounding areas, providing personalized care advice and treatments for foot problems.	Foot Care → Medical Foot Care ⁷¹⁰ Orthopedics → Foot Problems ⁹⁷⁷	corn ¹⁰¹ callus ¹⁰⁸ footcare ⁷⁶⁷ nails ¹⁷¹⁹ pedicure ²¹⁹⁶ treatment ²¹²⁰³	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
naturaldrives.nl	Natural Drives	Natural Drives is an organization offering coaching, training, and project management services to improve the performance of individuals and teams within organizations, with a focus on personal growth and results-oriented approaches.	Management & Consulting → Process Optimization ⁶⁵⁴	methods ⁴⁸¹ project management ³⁴²³ results ³⁹⁵⁴ coach ²⁵⁸¹⁰ training ²⁸¹³³	South-Holland → Rotterdam ²⁵⁰⁴⁸
nijmanstichting.nl	Maria and Adriana Nijman Foundation	The Nijman Foundation is a foundation dedicated to supporting charitable causes, particularly those focused on children and animals.	Farms & Farm Businesses → Care Farms ⁴⁷³	animal ²⁹⁰⁸ goal ⁴⁹⁷⁴ foundation ⁶⁶⁷⁸ child ¹¹⁵⁶⁶
oktoberfestzuidplas.nl	Oktoberfest Zuidplas	The Oktoberfest Zuidplas website is a promotional page for a German beer festival taking place on October 10, 2020, in a tent at the Hitland golf course parking lot.	Festivals → Beer Festivals ¹⁷⁵	oktoberfest ⁷⁴ ticket ²⁷⁸⁵ beer ²⁸⁸⁷ music ¹³¹⁷⁰	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
ondernemerskring-ouderkerk.nl	O.K.O. - Ondernemerskring Ouderkerk	The website of O.K.O. - Ondernemerskring Ouderkerk provides information about the business association, its members, board, and activities in the Krimpenerwaard region. The aim is to promote the business climate in the area and support collaboration between businesses, the municipality, and the province.	Associations → Regional Associations ²⁹² Associations & Groups → Business Associations ¹⁰¹⁸	business climate ²² business association ⁸⁴ region ⁵⁴¹² municipality ⁶⁸³⁷ member ¹⁰¹⁵⁴ collaboration ¹⁶⁰³⁶	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
ontvetterunit.nl	JM Private Label	The website offers degreaser units, parts, and cleaning products, specifically focused on the 'Bruikleen Concept'.	Logistics → Transportation ¹¹⁰² Household Goods → Cleaning Supplies ⁶³³	cleaning products ³⁰⁰ container ¹⁷⁰⁹ concept ³³³⁸ part ⁵⁰⁴⁴
pannenkoecci.nl	PANNEN KOECCI	The website showcases the PANNEN KOECCI designer bag, which is exclusively available at recognized Dutch pancake restaurants.	Family & Themed Dining → Pancakes ⁴⁹ Accessories → Bags ¹⁰⁰¹	shopper ⁵⁸ bag ²³⁹⁹ restaurant ¹¹²¹⁵ design ²⁷²⁰²	Bernheze → Heesch ³⁹²
partycentrumdestormpolder.nl	Partycentrum de Stormpolder	Partycentrum de Stormpolder is a party venue in Krimpen a/d IJssel that organizes and rents out events such as birthday parties, anniversaries, corporate events and weddings.	Venues → Party Venues ³⁶³ Venues → Wedding Venues ²³²	venue ⁸⁷⁹ hall ¹⁷⁸⁶ decoration ⁴⁰⁸⁵ event ⁴⁵¹⁹⁹
pem-vof.nl	PeM Lijstenmakerij	PeM Lijstenmakerij is a company that makes custom frames and advertising products for businesses and individuals.	Arts → Decorative Arts & Crafts ⁸²⁵ Home → Antiques & Collectibles ¹⁵²³	framemaker ¹⁹ advertising ²³⁰² frames ²⁵⁵⁶ workshop ¹⁹³²⁵	South-Holland → Waddinxveen ¹⁰⁴⁶
phicommunications.nl	PHI Communications	PHI Communications offers training, coaching, and career guidance services to individuals and teams throughout the Netherlands.	Training → Management Training ¹⁰²⁵ Human Resources → Talent Management ⁵³⁷	career guidance ²¹⁰ assessment ¹²⁰⁵ communication ¹⁰¹⁶² coach ²⁵⁸¹⁰ training ²⁸¹³³	South-Holland → Rotterdam ²⁵⁰⁴⁸
r-fc.nl	RF Consultancy	The website of RF Consultancy provides administrative services, including bookkeeping and tax advice, to SMEs in the region.	Government & Legal → Tax ¹³²²	sme ⁴⁶⁶ bookkeeping ¹³¹⁹ tax advice ¹⁵²² consultancy ²⁵⁹⁶ rate ²⁶⁰⁶	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
restaurantgino.nl	Restaurant Gino	The website of Restaurant Gino serves as an online platform for ordering pizzas, kapsalon (hair salon style dishes), Turkish pizzas and other meals, as well as for arranging deliveries to various surrounding villages and towns.	Italian Restaurant → Pizza Restaurant ³⁵¹ Food Delivery → Delivery ²²²⁷	turkish pizza ⁶³ kapsalon ⁵⁰⁹ pizza ⁴¹⁵⁸ menu ¹³⁸⁵⁶	Garmerwolde → Lageweg ¹²
rivodieselservice.nl	RiVo Dieselservice	The website RiVo Dieselservice offers advice, maintenance, and repair services for diesel engines, primarily focused on boats and vessels.	Parts → Engine Parts ¹⁷² Repair → Engine Repair ¹²⁹	vessel ²⁶² engine ⁷⁵⁸ diagnosis ¹⁴⁹⁰ boat ²⁹⁸⁰ repair ¹⁴⁵⁷⁶ maintenance ²⁰⁰⁹³	Netherlands → Zeeland ¹⁵⁴⁹³
rondomgroen.nl	Irene Schaaps	The RondomGroen website introduces the garden design and advice bureau of Irene Schaaps, focused on creating green outdoor spaces for individuals in the region.	Garden Maintenance → Gardeners ⁶⁸⁵ Garden Maintenance → Professional Garden Maintenance ¹⁶⁶	garden advice ⁴⁰ outdoor space ²⁴⁶ garden design ⁹⁶⁴ plant ⁴⁵⁰⁹
rpdevriestuinen.nl	R.P. De Vries Tuinen	The website of R.P. De Vries Tuinen presents a landscaping company offering services for the design and maintenance of gardens in Krimpen aan den IJssel and the surrounding area.	Garden Maintenance → Landscapers ²⁸⁷ Landscaping → Garden Installation ⁶¹⁷	timber construction ¹⁵⁷ paving ¹⁹⁴² quote ¹²⁸⁶³ garden ¹³¹²⁹ maintenance ²⁰⁰⁹³	South-Holland → Rotterdam-Rijnmond ⁸⁴
s-technology.nl	S-Technology	The website of S-Technology presents a company specializing in electrical engineering, data networks, home automation (domotica), and security technology, and is seeking clients for their projects.	Security → Intrusion Detection ¹³⁷ Security Systems → Security Technology ³⁹⁹	security technology ⁴⁷ data network ⁹⁰ home automation ³⁷⁶ electrical engineering ⁸¹⁷	South-Holland → Rotterdam ²⁵⁰⁴⁸
schoenmakergids.nl	schoenmakergids.nl	This website is a directory of shoemakers and locksmiths, organized by province in the Netherlands.	Installation & Repair → Tradespeople ⁴⁰⁹ TravelContent → Travel Guides ⁹³⁸	shoemaker ⁹¹ province ⁵¹⁸ locksmith ⁹¹⁹ city ¹⁸⁷⁵	Raalte → Luttenberg ⁵³²
seniorenkrimpen.nl	SeniorenKrimpen	The Seniorenplatform website provides information about the platform’s activities and its collaboration with the municipality of Krimpen aan den IJssel.	Social Issues → Senior Citizens ⁸⁶ Government & Administration → Local Government ⁴⁵⁹¹	police ⁴⁸⁰ municipality ⁶⁸³⁷
sequoiakrimpen.nl	VvE Sequoia Krimpen aan den IJssel	The website of the Residents' Association (VvE) Sequoia Krimpen aan den IJssel provides information to residents, family members, potential buyers, and visitors about the apartment complex and the VvE.	House Types → Apartment Living ³⁵⁵⁹ Neighborhood Organizations → Residents’ Associations ⁹⁶⁵	house rules ¹⁸ deck ²⁶⁸ vve ⁷⁴⁸
servicevansaar.nl	Service van Saar	Service van Saar is a service provider offering personal care, individual support, and household assistance to seniors and people with disabilities in the Krimpenerwaard region.	Care → Personal Care ⁵⁹²	companionship ¹²² household ³⁸² dementia ⁶⁷⁴ care ¹²³³⁸	Krimpenerwaard → Lekkerkerk ²⁴⁴
shibashop.nl	Shiba Shop	The Shiba Shop website offers a curated selection of dog-friendly toys, snacks, and accessories, primarily leashes, all handmade and designed in the Netherlands.	E-Commerce → Pet Supplies ¹⁰¹³ Animals → Dogs ⁵⁸⁷⁹	leashes ⁴⁰ atelier ¹⁴¹⁷ toy ²²⁹⁵ snack ²⁹¹⁶
smaragdinstallatieservice.nl	Smaragd Installatie Service	The website of Smaragd Installatie Service presents itself as a specialist in plumbing services, focused on carrying out small and large installations and repairs, and offers an overview of recent projects and customer reviews.	Heating → Central Heating ²³⁰ Installation & Repair → General Installation ⁷²⁷	water pipe ¹¹⁸ plumbing ¹⁷⁶¹ bathroom ³⁷⁸⁴ quote ¹²⁸⁶³ installation ¹³⁷⁴²
stoerwinterweken.nl	StoerWinterWeken	StoerWinterWeken is an organization that organizes winter weeks and winter sports events for young people with physical disabilities.	Social Organization → Youth Organizations ¹⁷²⁶ Winter Sports → Skiing ⁵⁹⁶	mission ¹⁰⁰⁰ volunteer ⁸³⁶⁷ event ⁴⁵¹⁹⁹
stolk-infra.nl	Stolk tuinaanleg & bestratingen	Stolk tuinaanleg & bestratingen is a company specializing in the design and construction of gardens and paving.	Gardening → Problem Solving ¹⁸ Garden → Paving ¹⁰⁰³	patio ¹⁵³ lawn ⁴²⁷ paving ¹⁹⁴² garden ¹³¹²⁹ installation ¹³⁷⁴² design ²⁷²⁰²
styledbyrachel.nl	Styled By Rachel	Styled By Rachel is a hair salon that offers women's and men's haircuts and styling services, with a focus on personalized attention and quality.	Men’s Issues → Men’s Fashion ¹⁵⁴	haircut ¹¹⁵⁸ styling ²³³¹ brand ¹⁷⁷³⁷
thecompanykitchen-krimpenaandenijssel.nl	The Company Kitchen	The website The Company Kitchen provides the option to order food online in Krimpen aan den IJssel, with a focus on sandwiches, lunch packages, and beverages.	Catering & Ready Meals → Takeaway ⁴⁰⁹	lunch package ²⁴ roll ³⁵⁸ beverage ⁵⁸⁶ bread ¹⁶²² sandwich ⁴⁰⁹⁸
themetalshop.nl	The Metal Shop	The Metal Shop is a family-run business specializing in all-round metalworking and producing custom furniture and decoration for both indoor and outdoor use.	Steel & Metal → Steel ¹⁶¹ Metal & Materials → Metalworkers ⁵⁸	metalworking ⁵⁶⁵ steel ¹¹⁷⁷ furniture ⁸⁷⁵¹ quote ¹²⁸⁶³ workshop ¹⁹³²⁵
trappenstofferen.nl	TRAPPENSTOFFEREN .NL	The website Trappenstofferen.nl is an online store offering customers the opportunity to order stair coverings and stair upholstery. The focus is on providing carpets from A-brands such as Bonaparte, Parade and Desso, primarily for upholstery of stairs in the Netherlands.	Flooring → Carpets ²⁹⁶ Building & Construction → Renovation ⁴⁴⁰³	stair covering ²⁸ carpet ⁸⁴⁰ assortment ⁷⁷⁹⁹ brand ¹⁷⁷³⁷	Alphen aan den Rijn → Boskoop ⁶⁵²
tuinenro.nl	Tuin & Ro	The website of Tuin & Ro is a portfolio and source of information about the landscaping services of the company, including project details and recent work.	Gardening → Sustainable Gardening ¹³³ Living → Sustainable Living ⁸¹⁷	gardener ²⁹⁹ volunteer ⁸³⁶⁷ garden ¹³¹²⁹ renovation ¹³⁸⁴⁹	Amsterdam → Center ⁹⁹⁰
uwparkmeubilair.nl	Outdoor Toys Krimpen	The website of Uw Parkmeubilair offers a wide range of outdoor furniture, including picnic tables, park benches, and garden tables, and provides professional installation and customization options.	Garden Furniture → Picnic Tables ²⁶ Economy → Retail & Commerce ⁹⁹⁴¹	garden table ⁵¹ picnic table ⁵² installation service ¹¹⁶ customization ¹⁷²³ showroom ⁴⁸⁸³
uzozorg.nl	UzoZorg	UzoZorg is a home care organization that provides customized care at home with a team of professionals.	Social Issues & Welfare → Social Security ³³⁶	professionals ¹⁹⁶⁶ care ¹²³³⁸ collaboration ¹⁶⁰³⁶	Rotterdam → Prins Alexander ⁴³²
vacaturesbijfluiconnecto.nl	Fluiconnecto B.V.	The website of Fluiconnecto B.V. offers job vacancies and information to potential employees.	Audio → Components ⁴⁸⁹ Industrial → Industrial Automation ¹⁰⁴²	logistics ³²⁵⁷ vacancy ⁶⁵⁹⁸	North-Brabant → Eindhoven ¹¹⁸⁴⁵
vanderhelbouw.nl	Van der Hel Bouw	Van der Hel Bouw is a construction contractor specializing in renovations, alterations, and maintenance services for both residential and commercial clients.	Renovation → Residential Renovation ⁹⁸	business property ⁷⁴ house ⁸¹²¹ renovation ¹³⁸⁴⁹ maintenance ²⁰⁰⁹³	Voorne aan Zee → Hellevoetsluis ⁹⁷²
vanerkelelektro.nl	Van Erkel Elektro	Van Erkel Elektro is an electrician offering 24/7 emergency service, electrical installation and maintenance.	Maintenance & Repair → Plumbers ⁸⁷⁹ Construction → Building & Materials ¹⁹⁴⁴⁹	trouble ³⁸ electrician ⁸¹⁹ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³
vanroonverwarming.nl	Van Roon Verwarming	Van Roon Verwarming is an installation company specializing in central heating and related services in the Krimpen aan den IJssel region.	Heating → Boilers ³³⁶ Retail & Supplies → Industrial Supplies ¹³³	boiler ¹²⁴⁰ heat ²¹⁸⁸ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
vanstaverenelektro.nl	Van Staveren	Van Staveren is a shop that offers a wide range of household appliances and services.	Repair → Household Appliances ¹²²⁶	picture ⁹² wash ²⁵⁴ cooling ³²⁰ cooking ⁸⁰¹ sound ¹⁶⁴⁹
vanvlietgraveertechniek.nl	Van Vliet Graveertechniek	Van Vliet Graveertechniek is a company specializing in engraving, milling, and sublimation of aluminum and plastic materials.	Plastics → Manufacturing ⁷⁷⁰⁸	sublimation ⁶¹ engraving ⁴¹⁴ aluminum ¹¹⁹⁷ plastic ¹²³²
verandagarden.nl	Veranda Garden	Veranda & Garden is a company specializing in the construction and installation of verandas, terrace coverings, carports, sun shading, and garden landscaping.	Garden → Garden Rooms ⁶⁶ Outdoor Living → Pergolas ²⁵³	overhang ¹⁸⁵ carport ²⁴⁸ sun shading ⁸³⁵ veranda ¹⁰⁵⁵ garden ¹³¹²⁹	Kampen → Zalk ⁵⁰
vmena.nl	VM&A	VM&A is a management and advisory firm specializing in the management and development of municipal real estate and project management.	Renovation → Residential Renovation ⁹⁸ Business & Management → Educational Consulting ⁵⁶¹	cv ⁵¹⁶ project management ³⁴²³ real estate ⁴⁹⁸¹ network ¹¹¹²³	South-Holland → Westland ⁴⁰¹⁶
vza-vuurwerk.nl	VZA Vuurwerk	VZA Vuurwerk is a fireworks shop located in Krimpen aan den IJssel that sells fireworks and accepts online orders.	Gifts & Flowers → Party Supply Stores ²⁴	fireworks ⁴¹³ opening hours ²⁹⁵³ shop ⁶⁴⁸³ order ⁶⁹¹²
weight4all.nl	Weight4all	The website of Weight4all offers weight loss consulting and fitness training, aimed at guiding people towards a healthier lifestyle.	Physical Fitness & Exercise → Weight Loss ¹¹⁴⁷	consultant ⁷⁰⁶ fitness ²²⁵¹ lifestyle ²⁹¹⁸ nutrition ⁴⁹³⁵ course ¹⁴⁷²⁸ training ²⁸¹³³
wenmei.nl	WenMei	The website WenMei offers a wide selection of hair and body care products, home fragrances, and gift sets, focusing on natural and environmentally friendly ingredients.	Hair Salons → Hair Care ²⁸⁴⁹ Cosmetics & Skincare → Body Care ⁸⁷	gift set ²¹⁷ soap ²³¹ shampoo ²⁵⁸ haircare ⁴⁶⁹	De Bilt → Bilthoven ⁹²⁰
werkgroepsamen.nl	Werkgroep Samen	The website of Werkgroep Samen presents information about ‘The Walk’, an annual commemoration and fundraising event honoring the Moluccans who arrived in the Netherlands 68 years ago. The aim is to keep the memory of this generation alive and to raise funds for the National Moluccan Monument.	Community & Social → Social Events ⁴¹⁶		Midden-Drenthe → Bovensmilde ⁷⁷
werkindemachinebouw.nl	Nidsa EU BV	The website 'Werk in de Machinebouw' is a platform connecting machine manufacturing companies with potential employees. It provides an overview of employers in the machine manufacturing sector, job vacancies, knowledge bank articles, news, and information about training and events.	Jobs → Vacancies ¹⁰⁹⁹ Plastics → Manufacturing ⁷⁷⁰⁸	knowledge base ⁵⁶⁹ job vacancies ¹²⁴¹ news ¹⁵²⁹³ training ²⁸¹³³	Hoeksche Waard → Heinenoord ¹²³
wimdeelenfotografie.nl	Wim Deelen Fotografie	The website of Wim Deelen Fotografie presents the work of photographer Wim Deelen and describes his activities, including conducting photography workshops for children at elementary schools and participating in the Fotoclub Molenwaard.	Arts → Imaging & Photography ⁷⁶⁸⁷	fotoclub ¹¹ photography ⁹⁵⁰³ workshop ¹⁹³²⁵	Rheden → Dieren ⁴⁶²
zvv-vhl.nl	Zvv VHL	The website of Zvv VHL provides information about the hall football association, its members, activities, and the opportunity to become a member or sponsor.	Football → Amateur Football ⁷⁵⁷ Football → Hall Football ⁶²	sponsorship ²⁶⁸⁶ match ³⁴⁷¹ membership ¹⁰⁴⁴² news ¹⁵²⁹³	South-Holland → Krimpenerwaard ¹⁸⁴⁰
smartphonereparatiezuidplas.nl	Smartphone Repair Zuidplas	Smartphone Repair Zuidplas provides professional smartphone and tablet repair services in the Zuidplas region.	Repair → Mobile Phone Repair ¹⁰¹²	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Zuidplas → Moerkapelle ²¹³
smartphonereparatieteylingen.nl	Smartphone Repair Teylingen	The website Smartphone Repair Teylingen offers professional repair services for smartphones and tablets, with locations in Teylingen, Sassenheim, Voorhout, and Warmond, and further in South Holland. The goal is to make scheduling repairs easy.	Mobile Phones → Smartphone Repair ⁷⁹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Teylingen → Sassenheim ⁵⁹⁹
smartphonereparatiekrimpenaandenijssel.nl	Telefoon Reparatie Krimpen aan den IJssel	The website provides smartphone and tablet repair services in Krimpen aan den IJssel and surrounding areas, specializing in professional repairs and boasting a long-standing reputation in the region.	Mobile Phones → Smartphones ⁴¹²	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷
smartphonereparatielansingerland.nl	Smartphone Repair Lansingerland	The website Smartphone Repair Lansingerland provides professional repair services for smartphones and tablets, with locations in Lansingerland and surrounding areas, and expanding its services to other locations in South Holland.	Repair → Mobile Phone Repair ¹⁰¹²	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Lansingerland → Bergschenhoek ⁵⁶⁸
smartphonereparatieleidschendamvoorburg.nl	Smartphone Repair Leidschendam-Voorburg	The website Smartphone Repair Leidschendam-Voorburg offers professional smartphone and tablet repair services in the Leidschendam-Voorburg region, with locations in Leidschendam and Voorburg.	Mobile Phones → Smartphone Repair ⁷⁹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
smartphonereparatiezwijndrecht.nl	Smartphone Repair Zwijndrecht	The website offers smartphone and tablet repair services in Zwijndrecht and surrounding areas.	Mobile Phones → Smartphone Repair ⁷⁹	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
smartphonereparatiepijnackernootdorp.nl	Smartphone Repair Pijnacker-Nootdorp	The website Smartphone Repair Pijnacker-Nootdorp provides professional smartphone and tablet repair services in the Pijnacker-Nootdorp region and beyond.	Computer → Computer Repair ⁸⁹⁸ Repair → Electronics Repair ⁷⁶	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
smartphonereparatiewestland.nl	Smartphone Repair Westland	The website Smartphone Repair Westland offers professional smartphone and tablet repair services, with locations in the Westland region and beyond.	Technology → Electronics & Components ¹¹²⁶¹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶	Westland → Monster ³⁶⁰
smartphonereparatiegoereeoverflakkee.nl	Smartphone Repair Goeree-Overflakkee	The website provides smartphone and tablet repair services in and around Goeree-Overflakkee.	Mobile Phones → Smartphone Repair ⁷⁹ Repair → Mobile Phone Repair ¹⁰¹²	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Goeree-Overflakkee → Ooltgensplaat ⁸³
smartphonereparatiebodegravenreeuwijk.nl	Smartphone Repair Bodegraven-Reeuwijk	The website Smartphone Repair Bodegraven-Reeuwijk provides professional repair services for smartphones and tablets, with a focus on the Bodegraven-Reeuwijk region and surrounding areas in South Holland.	Repair → Mobile Phone Repair ¹⁰¹² Electronics & Components → Mobile Phones ¹¹⁸⁶	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Bodegraven-Reeuwijk → Reeuwijk ⁵³¹
smartphonereparatiekrimpenerwaard.nl	Smartphone Repair Krimpenerwaard	The website Smartphone Repair Krimpenerwaard offers professional repair services for smartphones and tablets, with locations in Krimpenerwaard and surrounding areas. The goal is to be a reliable and specialist provider for smartphone and tablet repairs in the region.	Electronics & Components → Mobile Phones ¹¹⁸⁶ Electronics & Components → Tablets ¹⁹¹	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Krimpenerwaard → Bergambacht ³⁰³
smartphonereparatiegorinchem.nl	Smartphone Repair Gorinchem	The website provides smartphone and tablet repair services in and around Gorinchem, with locations in South Holland.	Repair → Mobile Phone Repair ¹⁰¹² Technology → Electronics & Components ¹¹²⁶¹	tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
vdsplus.nl	VDS+	The website of VDS+ presents an independent company specializing in various construction and interior jobs, emphasizing quality, service, and a personalized approach.	Design & Projects → Self-Employed Entrepreneurs ⁵⁰⁵ Finishing & Trades → Interior Finishing ⁹⁸	interior finishing ¹⁷ residential property ³³ commercial space ²⁴⁵ retail ⁵⁸⁶ logistics ³²⁵⁷
emviassist.nl	EMVI Assist	EMVI Assist is a specialist in assisting clients with successful bids in tenders.	Procurement → Tendering ⁷⁴ Construction & Maintenance → Procurement Consulting ²⁵⁰	bid ²³⁰ tender ³²⁹ review ¹⁸⁸⁸ plan ²⁵⁶⁶ design ²⁷²⁰²	Haarlemmermeer → Badhoevedorp ⁶⁰⁴
groenehartmassage.nl	Groene Hart Massage	The website of Groene Hart Massage provides information about various types of massages and on-site services.	Emergency & Safety → Alternative Healthcare ⁵⁶⁷	blood circulation ⁵⁷ immune system ²⁶⁹ reflexology ³⁸⁰ muscle ⁴⁹⁸ massage ⁷⁶⁴⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
starlightmusicservice.nl	Starlight Music Service	Starlight Music Service is a company that provides professional sound, lighting, and drive-in shows for various events and parties.	Events & Venues → DJs ¹⁰⁰¹ Electronics & Components → Audio ²³⁵¹	sound ¹⁶⁴⁹ light ⁵¹⁴⁸ rental ⁷²⁵⁷ event ⁴⁵¹⁹⁹	Krimpenerwaard → Lekkerkerk ²⁴⁴
365partyverhuur.nl	365 Party Verhuur	The website of 365 Party Verhuur offers party rental services, including various party items such as party tents, lounge heaters and folding chairs. The aim is to facilitate the rental of materials for organizing parties, with a focus on fast and clear communication and providing a clean and certified service.	Logistics & Transportation → Rental Companies ⁴¹⁴	party item ¹⁵ item ¹¹²⁵ region ⁵⁴¹² party ⁵⁹²⁸ rental ⁷²⁵⁷ communication ¹⁰¹⁶²	Voorne aan Zee → Brielle ⁶¹³
natuurmetarie.nl	Natuur met Arie	The website Natuur met Arie was launched in April 2021 with the aim of fostering engagement with nature and promoting its protection, with a particular focus on bird conservation and bat surveys.	Nature → Biodiversity ³⁸² Environment → Nature Conservation ¹⁸⁰³	bat ⁶³ excursion ⁶⁶² bird ⁹²² video ⁶⁷¹⁴ garden ¹³¹²⁹ blog ¹³³⁹²
gastouderijsseldijk.nl	DOT Gastouderbureau	This website presents the childcare provider Gastouder IJsseldijk and offers information about its approach, facilities, and contact details.	Childcare → Nanny Care ³⁰¹ Religion → Christianity ³⁸³⁹	routine ²²⁸ theme ⁴⁰¹⁵ atmosphere ⁵⁵⁹¹ child ¹¹⁵⁶⁶ care ¹²³³⁸
capelleaandenijssel-verstopping.nl	Folstra B.V.	The website of Folstra B.V. presents a plumbing company offering services in Capelle Aan Den IJssel and the surrounding region, focusing on unclogging, installation, and cleaning of drainage systems for both private individuals and businesses.	Home Improvement → Plumbing ²⁷³³	unclogging ²⁴⁴ drainage ¹³²² cleaning ⁴⁵⁶⁷ region ⁵⁴¹² quote ¹²⁸⁶³	Rotterdam → Hoogvliet ⁵¹⁶
aaccountants-nieuwerkerk.nl	AAccountants Nieuwerkerk	The website of AAccountants Nieuwerkerk offers accounting services to small and medium-sized businesses in the Krimpen aan den IJssel region. The goal is to relieve entrepreneurs of administrative burdens, allowing them to focus on their own business.	Business Services → Finance & Accounting ⁶⁶¹³	tax returns ⁴²³ account ⁵⁷⁸¹ administration ⁶⁵⁸⁷ collaboration ¹⁶⁰³⁶	Schouwen-Duiveland → Nieuwerkerk ¹¹⁰
sluistechniek.nl	SluisTechniek	The website of SluisTechniek offers security solutions, electrical installations, and solar panels, focusing on tailored advice and complete service.	Security → Intrusion Prevention ²³ Security → Alarm Systems ³⁵⁰	alarm system ⁴⁹⁵ electrical ¹⁴¹⁴ solar panels ⁴⁷⁰¹ security ⁶⁶⁵⁵
mondhygienistkrimpen.nl	Mondhygienist Krimpen	The website of Mondhygienist Krimpen presents the services of a dental hygienist and informs visitors about the practice, its approach, and the possibilities for oral care.	Dentistry → Dental Hygienist ⁶⁵¹	breath ²⁰⁹ gum ²¹³ smile ⁵¹⁴ dental hygienist ⁵²² practice ⁹⁰⁸⁹ treatment ²¹²⁰³
rotterdam-witgoedservice.nl	Witgoedservice Rotterdam	The website, Witgoedservice Rotterdam, provides appliance repair and installation services in Rotterdam and surrounding areas, offering a diagnosis for € 69.95 with a three-month warranty.	Household Appliances → Appliance Repair ²²⁴	appliance ⁹⁵⁶ diagnosis ¹⁴⁹⁰ warranty ⁴⁷⁰¹ installation ¹³⁷⁴² repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Lansingerland → Bergschenhoek ⁵⁶⁸
vrijebosdiertjes.nl	Vrije Bosdiertjes kinderopvang	Vrije Bosdiertjes childcare offers care for children up to 4 years old, utilizing a pedagogical approach based on Rudolf Steiner and Maria Montessori, emphasizing natural learning and child development.	Early Years → Childcare ⁶⁰²⁹ Early Years → Early Childhood Education ¹³⁴⁵	pedagogy ⁴⁰² childcare ³⁵¹² space ³⁸⁴⁶ child ¹¹⁵⁶⁶
jeroenvandijk.nl	Jeroen van Dijk Projectbegeleiding	The website of Jeroen van Dijk Project Guidance presents the services of a project manager and project coordinator with expertise in technical environments and work preparation.	Management & Consulting → Process Optimization ⁶⁵⁴ Research & Academia → Educational Development ³⁵⁴	project guidance ²⁶ work preparation ²⁹ project leadership ⁸⁵ business consulting ¹⁹⁸ project management ³⁴²³
zonnepaneleninkoopactie.nl	Zonnepaneleninkoopactie.nl	The website zonnepaneleninkoopactie.nl informs and facilitates residents and entrepreneurs in purchasing solar panels through municipal campaigns.	Energy → Energy Saving ¹¹⁵¹ Management & Consulting → Consultants ⁴⁴⁴	advisor ¹⁰⁵⁵ campaign ³⁴²⁸ registration ⁴³⁶⁶ solar panels ⁴⁷⁰¹ municipality ⁶⁸³⁷ energy ⁹⁰⁷⁵	Zwartewaterland → Hasselt ⁴⁹⁰
wirenco.nl	Wirenco BV	Wirenco BV is a supplier of wooden guide rails and fence systems, with a focus on safety and environmental protection.	Infrastructure → Road Infrastructure ²¹ Garden → Fences ⁸²⁴	fence ¹⁸¹⁴ safety ⁵⁸¹⁹ installation ¹³⁷⁴²	Southwest-Friesland → Sneek ¹⁹²¹
wsns-sliedrecht.nl	WSNS Sliedrecht	The website of WSNS Sliedrecht presents information about the reformatory SBO school, its history, current situation, and the school’s relocation from Barendrecht to Sliedrecht.	Primary & Secondary Schooling → Protestant Education ⁴² Education → Special Needs & Support ⁶³⁷²	sbo ²³ classroom ¹²¹ relocation ³⁶⁴ history ⁷²⁸⁶ school ⁷⁸⁵⁶	Vijfheerenlanden → Leerdam ⁶⁷²
rijnvisnotaris.nl	Rijnvis Notaris	The Rijnvis Notaris website provides notary services in Krimpen aan den IJssel, assisting individuals and businesses with legal matters such as drafting wills, buying or selling real estate, and handling estates.	Legal → Entrepreneurial Law ³⁸ Marketing & Branding → Entrepreneurs ⁵⁶²	deed ¹²⁹ will ⁵¹⁰ notary ⁷⁹¹ estate ¹⁰⁹⁹
berghuidtherapie.nl	Anouk van den Berg Skin and Edema Therapy	The website of Anouk van den Berg Skin and Edema Therapy presents her services as a skin therapist, primarily focused on cosmetic and medical treatments for the skin and edema.	Specific Conditions → Edema ¹⁹ Dermatology → Skin Therapy ⁶⁶¹	edema ¹⁴¹ skin therapy ²²¹ laser ⁸⁶⁸ practice ⁹⁰⁸⁹ treatment ²¹²⁰³
despanjekoerier.nl	The Spanje Koerier	The website provides express transport services to and from Spain.	Transportation Services → Freight Transport ³⁷⁸ Freight & Logistics → International Transportation ⁵⁷⁶	pickup location ³³ spain ³⁶³ courier ⁴⁷³ fleet ¹³⁵¹ rate ²⁶⁰⁶ transport ⁶¹⁰⁵	Pijnacker-Nootdorp → Pijnacker ⁷⁸⁸
nobilitasadvies.nl	Nobilitas Advies	Nobilitas Advies is an accounting firm offering a variety of bookkeeping and administrative services.	Accounting → Bookkeeping ¹²³⁰	bookkeeping ¹³¹⁹ tax ²¹⁰⁰ real estate ⁴⁹⁸¹ administration ⁶⁵⁸⁷
autoschadekrimpen.nl	Autoschade Krimpen	The Autoschade Krimpen website offers auto body repair, spray painting, and windshield repair services in Krimpen aan den IJssel and surrounding areas, continuing a tradition established by Autoschade Stormpolder.	Maintenance & Services → Car Care & Detailing ¹⁶⁶⁶	auto body repair ³⁸ windshield ⁹⁶ spray painting ¹⁷⁵ repair ¹⁴⁵⁷⁶
samenop30.nl	Samen op 30	Samen op 30 is a meeting location in Krimpen a/d IJssel offering modern, luxurious meeting rooms for 12 people.	Conferences & Meetings → Meeting Venues ⁷²⁹	pantry ¹⁹ local products ⁷¹ meeting room ⁶⁸⁵ atmosphere ⁵⁵⁹¹
liliscatcare.nl	Lili's Cat Care / KATTENOPPAS NEDERLAND	The website of Lili's Cat Care (now KATTENOPPAS NEDERLAND) offers a service for reliable and professional cat sitting at home throughout the Netherlands. The goal is to provide cat owners with a reassuring solution when they are away, with a team of experienced and verified caregivers.	E-Commerce → Pet Supplies ¹⁰¹³ Animal Care → Cat Care ¹³²	cat ¹⁵⁷⁸	Haarlemmermeer → Vijfhuizen ²²⁶
personal-manager.nl	NIVABE	The website of NIVABE is a landing page for a Personal Manager organization, which organizes the daily lives of people through knowledge and network.	Services → Personal Services ¹⁰⁶²	organize ¹⁶⁷ photo ⁷⁷⁷⁸ network ¹¹¹²³	Noordenveld → Huis ter Heide ⁹⁸
schildersbedrijf-klop.nl	Schildersbedrijf R. Klop	Schildersbedrijf R. Klop is a painting company located in Krimpen aan den IJssel, Netherlands, offering various painting and wallpapering services.	Interior → Wallpaper ¹⁰⁰¹	wall finishing ³¹⁰ wallpaper ¹⁷⁵⁶ paint ⁸⁷⁴⁷
verdooldblog.nl	Verdoold Makelaars	Verdoold Makelaars is a real estate agency offering services including residential, mortgage, and business brokerage.	Property Sales → Buying a House ⁸⁷² Financial Services → Insurance Advice ²⁵⁵	agency ⁹⁴⁴ mortgage ⁴⁵⁶⁴ insurance ⁶³⁵⁹	South-Holland → Krimpenerwaard ¹⁸⁴⁰
dkrglasvezelbeheer.nl	DKR Glasvezelbeheer	The website of DKR Glasvezelbeheer provides information about the installation of fiber optic connections in the Krimpenerwaard region, specifically targeting ‘outskirts’ areas overlooked by major internet providers.	Internet → Fiber Optic Internet ¹⁰⁰ Civil & Infrastructure → Infrastructure ¹⁰³³	business premises ¹⁸⁸ fiber optic ²⁷⁹ internet ¹⁶⁷⁸ region ⁵⁴¹² installation ¹³⁷⁴² collaboration ¹⁶⁰³⁶	Krimpenerwaard → Krimpen aan de Lek ¹⁹³
reparatie-centrale-rotterdam.nl	Reparatiecentrale Rotterdam	Reparatiecentrale Rotterdam offers direct appliance repair services with a guarantee to customers in the Rotterdam area.	Repair → Washing Machine Repair ²⁹	dishwasher ³²⁴ refrigerator ⁴⁷⁵ washing machine ⁴⁸⁷ appliance ⁹⁵⁶ warranty ⁴⁷⁰¹ repair ¹⁴⁵⁷⁶	Lansingerland → Bergschenhoek ⁵⁶⁸
mandysknipsalon.nl	Mandy's Knipsalon	Mandy's Knipsalon is a hair salon located in Krimpen a/d IJssel offering hairdressing services, both in the salon and at the client's home for those who cannot easily travel.	Hair Education → Hair Coloring ¹⁰⁶	hair salon ⁷¹⁷ coffee ³⁸³⁸ salon ⁵⁵⁴¹ home ⁷⁹⁷⁶ price ⁸³²⁸ appointment ¹³⁵¹⁰
paulschrama.nl	Paul Schrama	The website displays photographs of birds and insects taken by Paul Schrama.	Nature → Entomology ¹³ Animals → Birds ⁴⁷⁰	insects ²⁴⁵ bird ⁹²² photo ⁷⁷⁷⁸	Rotterdam → Pernis ¹⁴²
snoeicon.nl	Snoeicon B.V.	The website of Snoeicon Metal Constructions presents a metal construction company specializing in delivering custom steel constructions for various applications, including construction and industry.	Manufacturing → Metals & Fabrication ¹²²⁴ Building & Materials → Steel & Metal ⁷⁷⁹	steel ¹¹⁷⁷ construction ⁷⁴²¹
klusbedrijfvandriel.nl	Klusbedrijf Nico van Driel	The website of Klusbedrijf Nico van Driel showcases the services of a handyman business specializing in various jobs, including bathroom and kitchen renovations, and painting, and offers a request a quote form.	Kitchen → Kitchen Installation ¹⁹⁷ Maintenance & Repair → Skilled Trades ²²⁰	handyman ⁸³⁶ bathroom ³⁷⁸⁴ kitchen ⁶⁴⁴³ paint ⁸⁷⁴⁷ quote ¹²⁸⁶³	South-Holland → Hendrik-Ido-Ambacht ⁶⁶⁴
salonrebecca.nl	Salon Rebecca	The website of Salon Rebecca is an online platform for a beauty and medical pedicure salon located in South Holland. It serves to inform clients about the salon, book appointments, and offer their services.	Websites → Local Businesses ⁸⁵	beauty ⁶⁸⁴ foot ¹⁹²⁹ pedicure ²¹⁹⁶ salon ⁵⁵⁴¹ appointment ¹³⁵¹⁰	Krimpenerwaard → Ouderkerk aan den IJssel ¹⁴⁵
daadmetkracht.nl	Daad met Kracht! Advies in Leefbaarheid	Daad met Kracht! Advies in Leefbaarheid is an advisory firm specializing in improving the quality of life in neighborhoods and cities, particularly for government agencies and non-profit organizations.	Social Issues → Livability ¹⁰ Science → Research Methods ¹⁶	livability ²³⁰ municipality ⁶⁸³⁷	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
erikhoogendijk.nl	Erik Hoogendijk Stucwerk en badkamers	The website of Erik Hoogendijk Stucwerk en badkamers presents the services of a company specializing in plastering and the realization of complete bathrooms.	Construction Companies → Plasterers ⁸⁴³ Renovation → Bathroom Renovation ⁸³⁴	moldings ⁴⁶ decorative plaster ¹²⁰ plaster ²¹⁷⁵ bathroom ³⁷⁸⁴
anywaylifestyle.nl	Annemarie Den Hertog	Anywaylifestyle offers support and guidance to live a happier and more successful life by fostering self-awareness, organization, and conscious choices.	Mindfulness & Compassion → Positive Psychology ³¹² Wellbeing → Happiness ²³⁶	happiness ⁶⁵³ choice ⁸²⁷ awareness ¹⁷³⁵ life ²⁶⁷³ goal ⁴⁹⁷⁴
src-applicaties.nl	SRC Fire Protection Applications	The website SRC Fire Protection Applications offers fire protection solutions and services for commercial buildings, focused on preventing fire and limiting its impact.	Safety → Fire Safety ¹⁰⁴⁸	fire protection ⁹¹ commercial building ¹²⁷ installation ¹³⁷⁴² maintenance ²⁰⁰⁹³
rdepaterschilderwerken.nl	R. de Pater Schilderwerken	R. de Pater Schilderwerken is a painting company that offers various painting services.	Household & Cleaning → Spraying ³⁸⁷	woodwork ³⁸⁷ ceiling ⁶²⁷ wall ¹³⁷⁸ craftsmanship ¹⁸⁵⁸ paint ⁸⁷⁴⁷
opslagbijdeboer.nl	Opslagbijdeboer.nl	Opslagbijdeboer.nl offers affordable storage space in and around Bergambacht, with flexible rental terms and a personal approach.	Logistics → Storage ¹¹⁷⁰	flexibility ⁹⁹⁶ storage ²⁴⁴⁶ rental ⁷²⁵⁷	Krimpenerwaard → Bergambacht ³⁰³
oldbplayersevent.nl	Jillard Frenk & Remco van der Pluijm	The website promotes and organizes tennis and padel events specifically for former B-tennis players aged 40 and older in the Rotterdam region.	Tennis → Padel ⁸⁸⁰ Sports & Fitness → Sports Training ⁷¹¹	enjoyment ²¹² padel ⁶⁰² tennis ⁸³⁶ partner ⁴²⁷² event ⁴⁵¹⁹⁹	Zuidplas → Nieuwerkerk aan den IJssel ⁵⁵⁷
capelleaandenijssel-elektricien.nl	K.A. Techniek	The website of K.A. Techniek is an electrical contractor offering services in Capelle Aan Den IJssel and surrounding areas.	Lighting & Electrical → Utilities ³⁸⁸ Energy → Electricity ⁷¹²	power outage ⁸⁴ electrical panel ¹⁵³ electrician ⁸¹⁹ inspection ⁴²⁷⁹ installation ¹³⁷⁴² sustainability ¹⁸⁴⁵¹	Lansingerland → Bergschenhoek ⁵⁶⁸
praisebandtestify.nl	Testify	The Testify website is an online platform providing information about the praise band Testify, their performances, and Christmas praise events, with a focus on activities in the Rotterdam region.	Outdoor → Hiking ¹⁶⁹⁹ Religious & Spiritual → Religious Events ¹³¹	summer ⁴⁸³ region ⁵⁴¹² performance ⁷⁵⁸⁶ event ⁴⁵¹⁹⁹	South-Holland → Rotterdam ²⁵⁰⁴⁸
rijschoolzana.nl	Rijschool Zana	Rijschool Zana is an auto school offering affordable packages for obtaining a driver's license.	Driving & Vehicle → Vehicle Training ⁵⁵³	driving instructor ²⁵² traffic ⁹¹⁶ driver's license ¹²⁸³ package ⁶¹¹²	Nissewaard → Spijkenisse ¹⁴³³
kooymandieselservice.nl	Kooyman Dieselservice	Kooyman Dieselservice is a specialist in diesel engines and services for shipping and industry.	Boating → Engines ⁵² Manufacturing → Industrial Equipment & Services ¹²⁷¹	diesel engine ⁴⁹ part ⁵⁰⁴⁴ ship ⁵¹⁰³ maintenance ²⁰⁰⁹³
smartphonereparatiealphenaandenrijn.nl	Smartphone Repair Alphen aan den Rijn	The website provides smartphone and tablet repair services in Alphen aan den Rijn and surrounding areas.	Technology → Electronics & Components ¹¹²⁶¹ Context ¹⁶¹³⁹⁴	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Alphen aan den Rijn → Koudekerk aan den Rijn ¹³⁶
aannemingsbedrijfbal.nl	Aannemingsbedrijfbal.nl	The website of Aannemingsbedrijf Bal is an online presence of a construction company that has been active for 22 years.	Sustainable Building → Construction Projects ⁸²³	documentation ⁴⁵² address ⁹⁰¹ construction ⁷⁴²¹
pedicurepraktijksansom.nl	Pedicurepraktijk Sansom	Pedicurepraktijk Sansom is a pedicure practice located in Krimpen aan den IJssel specializing in the treatment of foot ailments and providing cosmetic foot care treatments.	Orthopedics → Foot Problems ⁹⁷⁷ Personal & Household → Household Services ¹⁰⁵⁰	foot massage ⁹⁶ nail polish ¹³³ foot problems ³²⁰ pedicure ²¹⁹⁶ relaxation ³⁹⁶⁸
hollandglas.nl	Holland Glas	Holland Glas is a Dutch glass supplier offering high-quality glass products for the construction market.	Building & Materials → Glass ⁶⁹⁷ Retail & Commerce → Commerce ⁸²⁴⁴	safety glass ⁵⁷ insulating glass ⁷⁴ glass ²⁹¹⁹	Overijssel → Almelo ²⁶⁹⁶
smartphonereparatiesdenhaag.nl	Smartphone Repair The Hague	The website offers smartphone and tablet repair services in and around The Hague.	Electronics & Components → Mobile Phones ¹¹⁸⁶	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ part ⁵⁰⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶	Wassenaar → Duindigt ¹⁵
huismanbouwentimmerwerken.nl	Huisman Bouw- en Timmerwerken	Huisman Bouw- en Timmerwerken is a construction and carpentry company based in Lekkerkerk, Netherlands, that offers renovation and building services in the surrounding area.	Building & Materials → Carpentry & Joinery ⁸³⁰	carpentry ²²¹⁸ renovation ¹³⁸⁴⁹	Krimpenerwaard → Bergambacht ³⁰³
dehollandscheijssel.nl	Van Schaik Grafimedia	The website presents and sells the photo book ‘De Hollandsche IJssel’ by Johan Nebbeling, a collection of photos of the Hollandsche IJssel.	Books → Publishers ¹⁰⁴⁰ Image Products → Photo Books ¹⁶	photo book ¹³⁵ bookstore ¹⁴⁹ region ⁵⁴¹² photo ⁷⁷⁷⁸	Zuidplas → Moerkapelle ²¹³
keijmelenpartner.nl	Keijmel & Partner V.O.F.	Keijmel & Partner is a cleaning service company that has been providing cleaning services since 1989.	Cleaning Services → Facade Cleaning ⁴¹⁸ Home Improvement & Services → Home Maintenance ¹⁰⁰²	interior cleaning ⁴² window washing ²⁵⁹ cleaning service ³²³ approach ⁹⁷¹ cleaning ⁴⁵⁶⁷
vanaerdenhoutbouw.nl	Van Aerdenhout Bouw BV	Van Aerdenhout Bouw BV is a construction company based in Schiedam offering renovation, build-out, and remodeling services to individuals and businesses in the Rotterdam region.	Renovation → Bathroom Renovation ⁸³⁴	build-out ¹⁴ remodeling ³³⁵ construction ⁷⁴²¹ renovation ¹³⁸⁴⁹ design ²⁷²⁰²	Nissewaard → Spijkenisse ¹⁴³³
vnpmedia.nl	VNP Media	VNP Media is a company that provides livestream, video, and audio production services, ranging from funerals to corporate events.	Live Events → Live Streaming ¹¹² Live Events → Videography ¹⁰³⁹	audio production ³² livestream ⁴⁷⁸ creativity ²⁵³¹ video ⁶⁷¹⁴
blo-milieuadvies.nl	BLO Milieu advies	BLO Milieuadvies is a consultancy firm specializing in environmental matters for businesses, including obtaining permits and environmental inspections.	Consulting → Environmental Consulting ⁵⁵⁵	environmental legislation ¹⁰ environmental permit ¹²³ air quality ¹⁶²
vijzelbedrijfvandam.nl	Vijzelbedrijf Van Dam	Vijzelbedrijf Van Dam is a company specializing in the straightening of leaning buildings.	Garden → Garden Sheds ⁴⁰⁰	shed ⁶³⁰ buildings ⁸⁹⁸ home ⁷⁹⁷⁶	Garmerwolde → Lageweg ¹²
djestiek.jouwweb.nl	Demodansgroep Djèstiek	The website of Djèstiek presents the dance group, its history, performances, and photos.	Dance → Dance Groups ⁵⁷	dance group ⁶⁰ choreography ¹⁰⁵ performance ⁷⁵⁸⁶ photo ⁷⁷⁷⁸ event ⁴⁵¹⁹⁹	Schagen → Dirkshorn ¹⁰⁵
krimpenaandenijssel.vvd.nl	VVD Krimpen aan den IJssel	The website of the VVD Krimpen aan den IJssel presents news, positions, and events related to local politics in Krimpen aan den IJssel.	Local Politics → Parties ⁶²² Local Politics → Political Parties ⁸⁹⁸	council ⁴²⁶ position ⁸⁷⁵ news ¹⁵²⁹³ event ⁴⁵¹⁹⁹	Krimpenerwaard → Schoonhoven ⁵⁴⁴
jatech.allparts.nl	AllParts Jatech	The website of AllParts Jatech is a cooperative of independent automotive wholesalers that provides garages with a complete package for the maintenance and repair of cars, including tires, materials, transport and shipping solutions.	Repair → Garage ¹⁷⁷⁹ Water & Environmental → Water Technology ¹⁹⁸	garage ¹²¹⁰ tire ¹⁹⁷⁵ part ⁵⁰⁴⁴ transport ⁶¹⁰⁵ network ¹¹¹²³ maintenance ²⁰⁰⁹³	South-Holland → Capelle aan den IJssel ¹⁶¹⁶
smartphonereparatiedordrecht.nl	Smartphone Reparatie Dordrecht	The website provides smartphone and tablet repair services in Dordrecht and surrounding areas.	Mobile Phone Repair → Electronic Devices ¹¹⁶	technician ⁸¹⁵ tablet ⁹⁹⁸ smartphone ¹³⁴⁴ appointment ¹³⁵¹⁰ repair ¹⁴⁵⁷⁶ brand ¹⁷⁷³⁷	Voorne aan Zee → Hellevoetsluis ⁹⁷²
uwoutdoorfitnesstoestel.nl	Outdoor Toys Krimpen	The website 'Your Outdoor Fitness Device' offers durable outdoor fitness equipment and complete play gardens, including advice, assembly, and custom solutions for various target groups.	Garden → Garden Supplies ⁷⁹¹ Nature & Outdoors → Outdoor ⁴⁰³¹	assembly service ¹⁹ equipment ⁴¹⁴³

Title:	Description:
About the site:	Website created by József Jároli. Initial release, site is still under development.
Legal disclaimer:	This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.
Advertising disclosure:	This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.

Title:

Description:

About the site:

Website created by József Jároli. Initial release, site is still under development.

Legal disclaimer:

This directory contains links to third-party websites. All information displayed originates from the respective websites and has not been fact-checked or endorsed by us. Promoted listings are clearly marked as such. We do not assume any responsibility for the accuracy, completeness, or reliability of content found on linked websites. Users access external sites at their own risk.

Advertising disclosure:

This website uses Google AdSense to display advertisements. Google and its partners may use cookies and other technologies to collect information about your visits to this site and other websites to provide relevant advertisements. You can opt out of personalized advertising by visiting Google's Ad Settings or YourAdChoices.com. For more information about Google's privacy practices, please review Google's Privacy Policy.